SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188586836|ref|YP_001918381.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|188586836|ref|YP_001918381.1|
Domain Number - Region: 8-86
Classification Level Classification E-value
Superfamily FlgN-like 0.0275
Family FlgN-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188586836|ref|YP_001918381.1|
Sequence length 147
Comment hypothetical protein Nther_2227 [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MEKLNEWKQYLEQHRKLTKRFLHLTERQENLLNKEKIDECLNLFDKKKQVMDEITELQKT
IAGYKEQYAHLVEEPLLSEIRELQSSSQENMETAMNKIENLEQEFNKRKLNIGEELKRVK
QDKQTVNTYFSSKNKSKGEGVFFDKKS
Download sequence
Identical sequences B2A821
457570.Nther_2227 WP_012448645.1.10671 gi|188586836|ref|YP_001918381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]