SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188586844|ref|YP_001918389.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188586844|ref|YP_001918389.1|
Domain Number 1 Region: 1-328
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.22e-70
Family Phase 1 flagellin 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188586844|ref|YP_001918389.1|
Sequence length 328
Comment flagellar hook-associated protein 3 [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MRVTNKMMSDNMLRNLNTNLRDMNHTQNKLSTGKRILSPSDDPAGTARTLDLRTEETELA
KYKQNVDDADSWLTSTDSALDEVDDVLQRVRELTIYAASDSVDQQSREALAAEVMELKEH
LVEVANTDFGGKHIFGGHNTTDKPFDMDDVEEMNGEEGEYNTFDVEYSGNRGRLNTDISS
DVTISKNLHGEEVFGSFDEEENGENGENGDEAISQNMFKMLDGVYDSMMEDDGGGTEKLS
NEHLQDLDHWIENNLDNRAEVGARQNRLELSKNRLQDIEHLTKEDLSETEEADMAKTIMD
LKSQENVHRMALSAGARIIQPTLLDFLQ
Download sequence
Identical sequences B2A833
gi|188586844|ref|YP_001918389.1| WP_012448653.1.10671 457570.Nther_2235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]