SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188586978|ref|YP_001918523.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188586978|ref|YP_001918523.1|
Domain Number 1 Region: 189-372,507-608
Classification Level Classification E-value
Superfamily Subtilisin-like 4.45e-73
Family Subtilases 0.0002
Further Details:      
 
Domain Number 2 Region: 401-505
Classification Level Classification E-value
Superfamily PA domain 0.0000000000118
Family PA domain 0.0094
Further Details:      
 
Domain Number 3 Region: 985-1047
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000000824
Family Copper amine oxidase, domain N 0.025
Further Details:      
 
Weak hits

Sequence:  gi|188586978|ref|YP_001918523.1|
Domain Number - Region: 927-967
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00889
Family Copper amine oxidase, domain N 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188586978|ref|YP_001918523.1|
Sequence length 1124
Comment peptidase S8/S53 subtilisin kexin sedolisin [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MAVAAILTCSTLLSPVTSPRPIEAARDKNWEYNSHEVADKTSRDIELAGAEGAEKNTPLT
NLVDREGKGASSLDELLELYEVETLTDLDEELILVAKIKQGEGSDHKEIILEKGNLSEKT
KSHGINLKVNHVYSEVFSGFSFQVSRDQLQDLFELSWIEEIHPVGMVETKGHRVYPQMEV
ERGWQLRPGSSLKGAGVNVAILDTGVDYTHSALGEGFGDGHKVVDGYDFVNRRRYPMDDE
GHGTHVAGIIAADGEFQGIAPKANILAYKVLDEHGEGSTDDILAALDQIVRDRRRGSANA
ADIINMSFGSRQEYVGSLIADALESAVDEGISVVMAGGNEGPRSSTLDFPNYFPQHNDSI
ITVGSSGAGAQEVNISASGISGFIYGELMLYSPAPDIDGSARIEYIEGGNNYSDFTNWAG
ESYVEDKIALVERGEGTYREMAENAARAGAKALIIYNNDPGMFYGSLVEPKDYIPTISIS
RGDGLEIRNQLNEGNVWVRMSNNSRIANFSSRGPSSESTVKPDLVAPGKNVMSTWTQDDY
SWSEGTSVSAAFVSGTVALMRQHNPGWSPDWVKSALMNSAEPLSDSAGRNYDPTTQGAGE
LRVHSALSSQTVVHPGSLSFDKIDYPGYRYYDSEQLTIYNNSGSTRRYRTRVNFLNGHED
LDIDPKSNTFFVSGGSKRELDLELSAATDSLPAGEYQGYVEIDDLTSARTFSIPFLVVMK
EGQDHNVGLEISPYAVSQEQHANINVRISDALDRLDIELYDEDQNYIERLHSRTSTLGPG
RHILSWRGQLSSGEPLDDGFYYLQANALPQGKDPTHEDNWLKISRKTAVDRTAPEIELDE
QVEDLYGEQGEETILVDTSPYSLTGRVEDLSLEISPQELELKIDGEKVDLDRDGKFQHQV
KLDEGSNMIDLRAEDWAKNSTELELEIIYDPHDIAVKLHDQELSLPVPPILDDGRILLPA
TSIVQALMGADMLSSLDAEQDPGDDEFVEISRQGQILKLISGEDTMYLADSSVEMERTPR
VVDGHFFVPLKEIAIPLGIQLAWDEDERAVLIEDTTTEIRYRHHMGKGSYSVSDINVPWT
VVMSRGYLLGRFLQDAYNLSSNPALESKFRSPFVDQYLENIIIE
Download sequence
Identical sequences B2A0Q5
457570.Nther_2370 gi|188586978|ref|YP_001918523.1| WP_012448785.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]