SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188584668|ref|YP_001916213.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188584668|ref|YP_001916213.1|
Domain Number 1 Region: 156-305
Classification Level Classification E-value
Superfamily TPR-like 1.37e-17
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000563
Family SinR domain-like 0.039
Further Details:      
 
Domain Number 3 Region: 74-191
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000131
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|188584668|ref|YP_001916213.1|
Domain Number - Region: 232-273,350-427
Classification Level Classification E-value
Superfamily TPR-like 0.00142
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188584668|ref|YP_001916213.1|
Sequence length 435
Comment transcriptional regulator, XRE family [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MGVVGNNIGQKIKRARYEKDMTQEELAGKDFNRSFLSQIEKGLVKPSDRVLSIIADRLNL
PLSYFYEPEDPDKDDEQAINALNKARNLIQSNKMDEALELITKSLKLQDISPKYAGLLMK
EQGEIYFQGNNIQKSLSSLKKAKIIFGDHKYHHELCSTLNHIGEIYNQSESYKEATQHLQ
QAINILEDHFVMDNILYLDVYFNLALSYLGEQKYHEAINTLTQAIPYSSKTNNFYNFGEL
HYLLGRCYQKTGKFAKARVAFETAIEQFVMFNKNKYTGKTQLALGELEETEGNLTSAERY
YLKALEQFTLLESNDQRERLKLKLLNIYLQLDKKEKIKGLAPFDLELVDSLSEKIDLSYE
LSKIHLEKEDFDNCFIVLQFLNDLVDRARRRKIFSDKKLLFYYSWMSHLYLNMEYYERGR
KCLKQCNSIIKKLGE
Download sequence
Identical sequences B2A313
gi|188584668|ref|YP_001916213.1| 457570.Nther_0026 WP_012446516.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]