SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDBG_02216T0 from Ajellomyces dermatitidis SLH14081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDBG_02216T0
Domain Number 1 Region: 142-386
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.57e-70
Family Glutamine synthetase catalytic domain 0.0037
Further Details:      
 
Domain Number 2 Region: 52-139
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 3.66e-19
Family Glutamine synthetase, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BDBG_02216T0
Sequence length 390
Comment | BDBG_02216 | Blastomyces dermatitidis SLH14081 glutamine synthetase (391 aa)
Sequence
MVSPNSLNSHPPSMLIAISRLTRWLLLRLEQAYPLPSTHLSNTENLMKYMSLDQRGHVMA
EYVWIDASSGVRSKTKTLKGPVKSVEELPEWNFDGSSTGQAPGENSDVYLRPIAMFPDPF
RRGDNILVLCETWDSDGSPNKFNYRHEAARLMRAHEDEHFWFGLEQEYTLLGADGWPYGW
PKGGFPGAQGPYYCGVGTGKVHCRDIVEAHYKACLYAGINISGINAEVMPAQWEYQVGPC
EGISLGDQLWMSRFLLARVAEEFGAIISFAPKPIPGEWNGAGLHTNVSTEAMRSEGGMKV
IEAAMKKLEARHSEHIAVYGEGNEDRLTGRLETGSIDTFSYGVADRGGSVRIPRQVAKDG
KGYFEDRRPASNADPYQITGIIVETLCGAS
Download sequence
Identical sequences XP_002627545.1.14838 BDBG_02216T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]