SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDBG_08752T0 from Ajellomyces dermatitidis SLH14081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDBG_08752T0
Domain Number 1 Region: 111-430
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.57e-55
Family Glutamine synthetase catalytic domain 0.0005
Further Details:      
 
Domain Number 2 Region: 13-100
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0000719
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDBG_08752T0
Sequence length 433
Comment | BDBG_08752 | Blastomyces dermatitidis SLH14081 protein fluG (434 aa)
Sequence
MAAEVVEKFFDAHPDIKFIRLQWVDYSGVLRTRITTKPRCFRIASGTDCCQLAQNCMVLP
ISTEPRCFPDGIEDWNLRPDWGTLMVCGFAPAHASVMCYTSHLGLTNPLARCPRNFLYEV
LAAFEAQYQSTLLMGFEIEFVLLDESSNLAQSFDRLVGSSMTAGLRTENLVIMEEIVASL
ELSGIEIYHFHTETINQFEVALSPLAPIQAIDALMMTQETIRTICIRHGLQATMTPRPVF
NGPRNGCHVHLSINPAPNAPCFLAGVLNKLKALCAFGLANYDSYHRVAGDCAGEWIAWGT
HNKDFPIRQFGPNRWELRFLDITANMYLFTAVMLSAGMDGMKQNIILSVRDCQVVPSALT
FEEAERQLRAFGITERMPKELEVSLDYAKDDKEIQNWVGAELFSQYVKVKEKEVEYFSKM
TDEERRQKFLGYF
Download sequence
Identical sequences A0A179V2A8 F2TTK6
XP_002620953.1.14838 BDBG_08752T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]