SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414073619|ref|YP_006998836.1| from Lactococcus lactis subsp. cremoris UC509.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414073619|ref|YP_006998836.1|
Domain Number 1 Region: 40-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.22e-71
Family Phosphate binding protein-like 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414073619|ref|YP_006998836.1|
Sequence length 287
Comment D-methionine-binding lipoprotein plpC precursor [Lactococcus lactis subsp. cremoris UC509.9]
Sequence
MNPKNRNIIIAVAVLILVALVAFFSLNHQGGVKASAGEKTVKVGIMSGDKQDQEVWKSVA
KTAKEKYDLKLKFVYFYDYNQPNEALLSGDIDINAFQSYNYVKTWNKAHKSDIVAVGNTY
ITPMHIYSKEISKLSDLKEGSTVAIPNDASNESRALFVLQSAGLLKLTTSDSSKLVGLPD
ITENPHQLKFKEVDASQTPRALDSVALSVVNYNYATAASLPKSESVFMEPLNKTSAQYIN
FIAATSKEKNNKVYKEVAKAYASKATEKAIKEQYPDGGELPAWDLKL
Download sequence
Identical sequences gi|414073619|ref|YP_006998836.1| WP_015082002.1.14741 WP_015082002.1.37992 WP_015082002.1.90014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]