SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188587767|ref|YP_001919801.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188587767|ref|YP_001919801.1|
Domain Number 1 Region: 186-460
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 1.96e-68
Family Fe-only hydrogenase 0.0000667
Further Details:      
 
Domain Number 2 Region: 133-204
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.05e-18
Family Short-chain ferredoxins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188587767|ref|YP_001919801.1|
Sequence length 494
Comment iron-dependent hydrogenase [Clostridium botulinum E3 str. Alaska E43]
Sequence
MFKFENQLIKLKHDVLSNIVRLAKEDNINKENLDKIPYEMLPGNEPQYRESVVHEREVLL
ERLKLASGFIPNGKGTDELVNIEDEKQILYVIKNACDMCPTKKFEVTDACRNCIAHKCQS
VCNFGAITYVDGKAYIDPDKCKECGMCKKACPYDAIAEDMRPCKRSCPTGALDINSDKRA
MIKQEKCVNCGACMAACPFGALEDRSLLVKIVKELTNNSNIYAVVAPAITGQLGPKTGYG
QVKNAIKKLGFTDMVEAACGADAVTVHESNEFVERMENGDPYMTNSCCPGFLSYIEKMMP
DQVDRISGTVSPMVAAGRFIKANDKDAKVVFIGPCTAKKSEILRDSIKDAVDYVLTFEEL
LALFEGFNIDPANFYDIVVDEASIFGRGFGVGGGLTAAIENYIKDKGIDCEFKPVKVSGG
AEIKKTMMMAKMGRLPGNFIEGMMCEGGCINGSGKILSPMKAKSSFNKVNQQATMKNVLE
NSKIDDYKDIDLER
Download sequence
Identical sequences 508767.CLH_0368 gi|188587767|ref|YP_001919801.1| WP_012449595.1.16164 WP_012449595.1.17341 WP_012449595.1.1917 WP_012449595.1.31784 WP_012449595.1.32697 WP_012449595.1.53901 WP_012449595.1.58365 WP_012449595.1.64452 WP_012449595.1.9385 WP_012449595.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]