SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188587898|ref|YP_001920057.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188587898|ref|YP_001920057.1|
Domain Number 1 Region: 109-171,233-304
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-27
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 152-231
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.33e-19
Family Short-chain ferredoxins 0.06
Further Details:      
 
Domain Number 3 Region: 16-82
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000572
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188587898|ref|YP_001920057.1|
Sequence length 345
Comment sulfite reductase subunit C [Clostridium botulinum E3 str. Alaska E43]
Sequence
MIGNLDLQALRRNEYRESKVRGNFMVSIRIPGSIFPANLLPIVQEIAEKYGSGKIHMQTR
QKLSIPDISYKHIDEVNKLLAPIIEELEVKTCGIELPDIHDGYATIGARNIMNCIGSYHC
IFANSDTISLARKLEKDIYPNDYHIKIAVSGCPNDCSKANFTDLGIMGISKIDFDYDRCV
GCGACVKECKQHVTSALYGKDGKAAKQIDKCIGCGACVKVCPTMAWSRSNKKFYWVKIGG
RTGKQTPRAGKTMFMWITEEPLRQIVKNIFKFQDYVLNGKPVYRHFGHLIDEASYRVFRD
FILGNSPEAEGLQVPKVILNEEALVADRIYWAEDETVARIHMRKY
Download sequence
Identical sequences 508767.CLH_0662 gi|188587898|ref|YP_001920057.1| WP_012449704.1.53901 WP_012449704.1.58365 WP_012449704.1.64452 WP_012449704.1.9385 WP_012449704.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]