SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588130|ref|YP_001920151.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588130|ref|YP_001920151.1|
Domain Number 1 Region: 788-1165
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.56e-134
Family PFOR PP module 0.00000000296
Further Details:      
 
Domain Number 2 Region: 415-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-88
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000439
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-78
Family PFOR Pyr module 0.0000000118
Further Details:      
 
Domain Number 4 Region: 258-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.57e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000146
Further Details:      
 
Domain Number 5 Region: 671-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.37e-19
Family Ferredoxin domains from multidomain proteins 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588130|ref|YP_001920151.1|
Sequence length 1166
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium botulinum E3 str. Alaska E43]
Sequence
MRKMKTMDGNTAAAHVSYAFTEVTAIYPITPSSPMAEHVDEWVAQGRKNIFGQTVKVMEM
QSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKISGEMLPGVFHVSARALATSSL
NIFGDHQDVMAARQTGFAMLAEGSVQEVMDLSAVAHLTAIKSRIPFLNFFDGFRTSHEIQ
KIEVLDYADLAKLVDMDAVKAFRARALNPDHPVTRGTAQNADIYFQERESVNKFYNELPD
MVESYMAEITKITGREYHCFDYYGAEDADRVVIAMGSVTDVAEETVDYLNAHGQKVGLVK
VRLYRPFSVEKLIAAIPSTVKKIAVLDKTKEPGADGEPLYLDIRNAFYGKENAPVIIGGR
FGLGSKDPNPAHIAAVYDNLAKAEPKNGFTIGIVDDVTNTSLEVTEDIDATPEGTTACKF
WGLGSDGTVGANKSAIKIIGDHTDMYAQGYFFYDSKKSGGITVSHLRFGKKAIKSPYLIN
KADFVSCSNQSYVHKYNVLEGLKPGATFLLNTIWTPEELEEKLPASYKRFMANNNIKFYT
LNAVAIAQEIGLGGRINMIMQSAFFKLANIIPVEDAVKYLKDSVVTSYGKKGEKVVNMNN
AAIDKGVESIVEIKLPEAWKTAKDEEVAPLKNASEFVKNIVVPMNRQEGDSLPVSAFVGM
EDGTFEAGTAAFEKRGIAVNVPEWDAEKCIQCNQCSLVCPHAAIRPILLNEAEKNAAPAN
ATIVDAKALKSEEKLFYTMAVAPLDCSGCGNCAQICPAPGKALVMKPQESQHNQIEVWDY
LVDEVSTKKNPMNKNTVKGSQFEQPLLEFSGACAGCGETPYAKLITQLFGDRMMIANATG
CSSIWGGSAPSTPYTKNKEGHGPAWANSLFEDNAEYGLGMFLGVRAIRERIQERAEAAIA
ANDPAKAELQDWLENMNEGAGTRDRAAKLVAALEKSGTEAAKEILAEKDYFVKRSQWIFG
GDGWAYDIGYGGVDHVLASGEDVNVFVFDTEVYSNTGGQSSKSTPTAAIAKFAAAGKRTK
KKDLGMMAMTYGYVYVAQINMGADRNQVLKAIAEAEAYKGPSLIIAYAPCINHGIKLGMS
NSQLEAKRATECGYWAMYRFNPELKGTKNPFTLDSKAPTADFKEFLMGEVRYASLAKAFP
EAAEALFEKTYTDAMERLEGYKKLAE
Download sequence
Identical sequences A0A0C2S7G9
WP_012449882.1.10246 WP_012449882.1.14003 WP_012449882.1.16164 WP_012449882.1.17341 WP_012449882.1.1917 WP_012449882.1.32697 WP_012449882.1.43682 WP_012449882.1.47997 WP_012449882.1.53901 WP_012449882.1.58365 WP_012449882.1.64077 WP_012449882.1.64452 WP_012449882.1.65636 WP_012449882.1.73899 WP_012449882.1.87966 WP_012449882.1.92433 WP_012449882.1.92626 WP_012449882.1.9385 WP_012449882.1.97908 gi|188588130|ref|YP_001920151.1| 508767.CLH_0756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]