SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588162|ref|YP_001921431.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588162|ref|YP_001921431.1|
Domain Number 1 Region: 188-562
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 9.68e-116
Family Fe-only hydrogenase 0.000000106
Further Details:      
 
Domain Number 2 Region: 75-213
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.51e-38
Family Ferredoxin domains from multidomain proteins 0.0043
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-16
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188588162|ref|YP_001921431.1|
Sequence length 565
Comment periplasmic [Fe] hydrogenase 1 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MSKYMIIDGNRVEFDNEKNILDLVRKAGIDLPTFCYYSDLSIYGACRMCVVEDEWGGIIA
SCSTPPKDKMSIKTNTPKLHKHRKMILELLLASHCRDCTVCEKSGKCRLQELALRFGVKT
IRFKNENEKIELDTSSKSIVRDPSKCILCGDCVRMCNEIQNVGAIDFAYRGSNMIVSPAF
GKCLGETDCVNCGQCANVCPTGAIVVKSDVKPVWKALYNPKQRVVAQVAPAVRVALGEEF
GVKPGENVMDKIVAAMRKLGFDEIYDTSLTADMTIIEESNEFLQKLESGDNKLPLFTSCC
PAWVRYVETKHPELMKYVSTCKSPMQMFGSVIKEYFKENDSLEEKETISVAIMPCTAKKA
EAAREEFITNGIKDIDYVITTTELCKMINEAGLQFDKIEPESSDMPFSLYSGAGVIFGVT
GGVTEAVIRGVVEDKSSKALKEIEFIGVRGMDGVKICEVPFGEKNLRIGVVSGLANAENL
IDKIQSGEEHFDFVEVMACPGGCIAGAGQPFSLKEGNKERAKGLYKVDKVTQIKRSQENP
VLISLYNGLLKERSKELLHVHYEHE
Download sequence
Identical sequences A0A1X2J4S3
gi|188588162|ref|YP_001921431.1| WP_012449909.1.16164 WP_012449909.1.17341 WP_012449909.1.32697 WP_012449909.1.43682 WP_012449909.1.58365 WP_012449909.1.64452 WP_012449909.1.65636 WP_012449909.1.92433 WP_012449909.1.9385 WP_012449909.1.97908 508767.CLH_2050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]