SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588165|ref|YP_001921458.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588165|ref|YP_001921458.1|
Domain Number 1 Region: 790-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.01e-128
Family PFOR PP module 0.00000000387
Further Details:      
 
Domain Number 2 Region: 416-670
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-86
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000101
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.45e-75
Family PFOR Pyr module 0.0000000225
Further Details:      
 
Domain Number 4 Region: 259-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000183
Further Details:      
 
Domain Number 5 Region: 672-835
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.85e-20
Family Ferredoxin domains from multidomain proteins 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188588165|ref|YP_001921458.1|
Sequence length 1172
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium botulinum E3 str. Alaska E43]
Sequence
MMRRTKTMDGNTAAAHISYGFTEVAAIYPITPSSPMAEHVDEWASQGRKNIFGEPVKMVE
MQSEAGAAGAMHGSLQAGALTTTYTASQGLLLMIPNMYKIAGEKLPCVMHVSARALATSS
LSIFGDHQDVMAARQTGFAMLAETSVQEVMDLSGVAHLAAIKGKIPFVNFFDGFRTSHEI
QKIEVIEQDELAKLVDYNAIDEFRKNSLNPNHPVTRGTAQNPDIYFQTREAVNKAYDDVP
SIVEEYMSEITKLTGREYHCFDYYGAKDADRIIISMGSVNDVVEETVDYLNNNKQKVGLV
KVRLYRPFSVERLLKVIPKSVKKIAVLDRTKEPGAIGEPLYLDVVRCLYGKKDAPIIVGG
RFGLGSKDPTPSHIAAVFDNLISDEPKNQFTIGITDDLTNTSLKLHEDINATPEGTTSCK
FWGLGSDGTVGANKSAIKIIGDHTDMYAQGYFDYDSKKSGGITVSHLRFGKELIKSRYLI
DKADFIACHNQSYVYKYNVLKGLKKNARFLLNTIWDKDELDEKLPASMKKFIAENDIEFY
TINAIKIAQEIGLGGRINMIMQAAFFKITNIIPVEDAVKYLKEAVVNSYGKKGEKVVRMN
NDAIEAGVEGVVKIEIPAGWKNSIDEKNEFSKDLPAFIREIVNPMNRLEGDSLPVSTFVK
HNLEDGTFMAGTTAYEKRGIAVNVPEWLQDKCIQCNQCSYVCPHATIRPFLLNEEEKSKA
PSSIKLIEPKALKSDEKLYYSIGVTPLDCTGCGNCVEVCPAPGKALIMKPQASQHDQIEV
WDYTVEKVTNKNPMNKNTVKGSQFEIPLLEYSGACAGCGETPYAKLITQLFGDRMMIANA
TGCSSIWASGAPATAYTKNQQGHGPAWANSLFEDNAEFGYGMHLGVKAIRERIAHNIEVA
LNSDLSENTKEVLKDWLDHKDCGEGTRDRSNKVIEVLEKENNELAKVILKDKEFLVNRSQ
WIFGGDGWSYDIGYGGLDHVIASGENVNIFIFDTEIYSNTGGQASKSTPTAAIAKFAASG
KRTKKKDLGMIAMTYGYVYVAQIAMGADKNQTLKAICEAENYDGPSLIIAYAPCISHGIK
IGMSNSQEEEKKAVECGYWSLYRYNPTLKGVKNPFSLDSKEPKGNFREFLMGEVRYSSLA
KVFPELSEELFKKTEEDAIERYNNYKKLASQE
Download sequence
Identical sequences 508767.CLH_2077 gi|188588165|ref|YP_001921458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]