SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588322|ref|YP_001919488.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588322|ref|YP_001919488.1|
Domain Number 1 Region: 190-574
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 6.54e-132
Family Fe-only hydrogenase 0.000000000047
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.77e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000723
Further Details:      
 
Domain Number 3 Region: 134-208
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.37e-16
Family Ferredoxin domains from multidomain proteins 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588322|ref|YP_001919488.1|
Sequence length 576
Comment hydrogenase-1 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MAYILINEKEVFVKEEGKTILEVALENNIEIPTLCYLNDCSNTGKCGVCAVEIEGQEELA
LSCETLVQDKMVIRTDSEKVQEAIKLRVAEMLDKHEFKCGPCKRREDCEFLKLVIKTKAR
ANKPFIVKDKSEYVDDRSKSIVIDRSKCVLCGRCEAACSEKTATNSIKIIDDNGDKKVAT
IDGKCFDDTNCLLCGQCIAACPVDALSEKSHTERVQNALEDPNKHVIVAMAPSVRAAMGE
AFKMGYGVDVTGKIYTALRMLGFNKIFDINFGADMTIMEEATELISRVNEGGPFPMFTSC
CPSWVREVENYFPEFIDNLSSAKSPQQIFGAASKTYYPEIEGLDAKDVFTVTIMPCTSKK
FEADREEMENNGLRNIDAVITTRELAKMIKTAKINFSTLEDSEADPSMGEYTGAGAIFGA
TGGVMEAALRSAKDFIENKSLEEIEYEQVRGLEGIKEATVTLGGQEYNIAVINGAANVFD
FVKSGRMEEKQYHFIEVMSCPGGCVNGGGQPHVNSKDRSKIDIRTVRASVLYNQDKGLSK
RKSHENASLLKMYETYMGKPGKGLAHELLHIKYKKK
Download sequence
Identical sequences WP_012450040.1.58365 WP_012450040.1.9385 WP_012450040.1.97908 gi|188588322|ref|YP_001919488.1| 508767.CLH_0034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]