SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588530|ref|YP_001921030.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588530|ref|YP_001921030.1|
Domain Number 1 Region: 187-566
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 3.01e-125
Family Fe-only hydrogenase 0.0000000572
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.68e-31
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0014
Further Details:      
 
Domain Number 3 Region: 134-204
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000178
Family Ferredoxin domains from multidomain proteins 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588530|ref|YP_001921030.1|
Sequence length 582
Comment iron hydrogenase 1 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MVKLKIDNIDVEVEKGTTILDAAKSFKIQIPSLCYLKDINEIGACRVCIVEVKGKDKLLP
ACNNVVEDGMEIFTNSPRVRETRRTNIKLILSQHDCHCATCVRSGNCNLQNIANDLGVIT
IQYKRMIEPYLWDERFPLIRDARKCIKCMRCIQVCNKIQSLNIWDVSNTGTRTTVDVSLN
RKIQDSDCSLCGQCITHCPTGALRERDNTQKAFDVLSNKDKITVLQIAPAVRASWGESLG
LTKEKATVKRLVSALRKIGFDYIFDTNFAADLTIMEEGSEFLERLQNNTNLPMFTSCCPA
WVRFLKSQYPDMTKMLSTAKSPQQMFGAIAKSYYAKLLNVDPSKIYCISIMPCIAKKHEA
EIPIMNDAGYGQDIDLCLTTREVERMIRSEHIIANDLNESDFDTPLGIGSGAGVIFGSTG
GVMEAALRTAYFLTCGNNPDPNAFKEIRGMNGIKEASFEINNTKLKVAVVSGLNNARNLI
KNLRKGNVYYDFIEVMACPGGCSGGGGQPIKDGIELAETRSKMLYELDELSDIRFSHENP
SILNVYKEFLEKPLSNVSHKLLHTDHNLWEMPLSPGLDIDDK
Download sequence
Identical sequences WP_012450195.1.1917 WP_012450195.1.53901 WP_012450195.1.58365 WP_012450195.1.9385 WP_012450195.1.97908 gi|188588530|ref|YP_001921030.1| 508767.CLH_1644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]