SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588547|ref|YP_001920769.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588547|ref|YP_001920769.1|
Domain Number 1 Region: 13-155
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.48e-22
Family Short-chain ferredoxins 0.088
Further Details:      
 
Domain Number 2 Region: 93-281
Classification Level Classification E-value
Superfamily Radical SAM enzymes 4.45e-18
Family MoCo biosynthesis proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588547|ref|YP_001920769.1|
Sequence length 317
Comment glycyl-radical enzyme activating family protein [Clostridium botulinum E3 str. Alaska E43]
Sequence
MGNMNLGMIERKATIFNIQKYNMYDGPGIRTLIFFQGCPLRCKWCANPEGMIKKYRVMFK
KNSCVNCGACVDACPVGIHTISKESLKHEVNHNIDCLGCGKCVDACLESSLSIVGQVKTI
SELLEIIEEDRAFYDISGGGVTLGGGEVLMQPEAACNLLMACKQEGINTAIETCGYAKLE
SVLKVAEFTDLFLFDIKHIDSDRHFQLTGVRNEQILENLKELIRRKYNVKIRMPLLKGVN
DSNEDIENAMKFLIQFKDYKNFKGIDLLPYHKMGVNKYKQLGIEYPIEGDPSLNNEDLDK
IESWIKKYDLTATVIRH
Download sequence
Identical sequences A0A0C2NXX7 C5UWD1
508767.CLH_1377 gi|188588547|ref|YP_001920769.1| WP_003371709.1.10246 WP_003371709.1.14003 WP_003371709.1.14250 WP_003371709.1.1917 WP_003371709.1.31784 WP_003371709.1.32697 WP_003371709.1.43682 WP_003371709.1.47997 WP_003371709.1.58365 WP_003371709.1.64077 WP_003371709.1.64452 WP_003371709.1.65636 WP_003371709.1.73899 WP_003371709.1.87966 WP_003371709.1.92433 WP_003371709.1.92626 WP_003371709.1.9385 WP_003371709.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]