SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588713|ref|YP_001921272.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588713|ref|YP_001921272.1|
Domain Number 1 Region: 120-434
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 7.06e-75
Family Fe-only hydrogenase 0.00015
Further Details:      
 
Domain Number 2 Region: 92-135
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000438
Family Short-chain ferredoxins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588713|ref|YP_001921272.1|
Sequence length 451
Comment [Fe] hydrogenase [Clostridium botulinum E3 str. Alaska E43]
Sequence
MNNKYLDLFDTLVKSYYDGNFDETLNRIMVCHEVSPQETFEIITSLCGVKLKFDNNYVYN
IKKAITEYTVNKRIVEKLECCGANCTPNKEKKYTCELACPFNAIYYDSEKNSTAINKDMC
INCGICVDSCKNGRILDKVEFLPIINLIKENKTVIAAVAPAIAGQFGENVTMDQLREAFI
KAGFTDMVEVAFAADILTVKEAVEFNKHINKPDDLMITSCCCPMWVGMLKKVYKELVPDL
SPSVSPMIAAGRILKKLNKDTKVVFIGPCIAKKAEAKEKDLVGAIDFVLTFQEVEQIFRA
LEINPMDLHGVPSVEYASKAGRLYARTGGVSIAVSETIEELYPEKFKNFKSVKVDGIKDC
KAILDKALKKEVDANFIEGMGCPGGCVGGPKAIVPPTKSRIAVDEFAYDSPIKVPVHSKV
LDDVLSKIGINSIDDFKDPKKIEILERDFFN
Download sequence
Identical sequences A0A1X2J695
508767.CLH_1891 gi|188588713|ref|YP_001921272.1| WP_012450342.1.43682 WP_012450342.1.47997 WP_012450342.1.53901 WP_012450342.1.58365 WP_012450342.1.87966 WP_012450342.1.9385 WP_012450342.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]