SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588740|ref|YP_001921919.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588740|ref|YP_001921919.1|
Domain Number 1 Region: 41-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.47e-16
Family Short-chain ferredoxins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188588740|ref|YP_001921919.1|
Sequence length 218
Comment 4Fe-4S ferredoxin [Clostridium botulinum E3 str. Alaska E43]
Sequence
MNKFLVLWKKYSFVILMMFILLGLFDARIALLAIICMVAPIIVSLFKGRFWCGNLCPRGS
FYDNVVSKFSNKRKVPKFLKSYYFRAIVFVGMMTMFGLGIKQNLGNLYGIGMVFYRMIVV
TTIIGIVLSLFYNHRTWCNFCPMGSVASIISKFKKSKKVLQVSSSCVSCKMCEKKCPLGI
VPYEYKGDILSHPDCIQCGQCVSVCPKNAVGYDKITLK
Download sequence
Identical sequences gi|188588740|ref|YP_001921919.1| WP_012450367.1.58365 WP_012450367.1.9385 WP_012450367.1.97908 508767.CLH_2539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]