SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188588987|ref|YP_001919988.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188588987|ref|YP_001919988.1|
Domain Number 1 Region: 2-293
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.03e-65
Family FMN-linked oxidoreductases 0.0000334
Further Details:      
 
Domain Number 2 Region: 285-359
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.24e-16
Family Short-chain ferredoxins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188588987|ref|YP_001919988.1|
Sequence length 362
Comment dihydroorotate dehydrogenase family protein [Clostridium botulinum E3 str. Alaska E43]
Sequence
MAKLKVNILGMEFNNPIFTAAGPGAKDGELCVSAVKGGAGGLVTKTISEKPADVPRPCMA
KTNAGFLNTELWSELPKEQWIEKEYKRAKEAGVPMIVSMGYTADQIKKVAPLVKPYADAV
ELSTHYVGTDIAPIVESMKAAKAALDCPVFMKMSPHTDIQKIAKALEEAGADGLVMINSV
GPCMAIDIETGYPIMGSQTGYGWLSGSAVKPVAIRNIYDASKVIKIPIIGVGGITCGKDA
AEMLMAGAQSVQVCTEAILKGPTVYGKIAKELNEFLDSHGYKDVNEIIGLAHKKCEERDF
RTESIPPKVNQDACIKCGICKTSCVYDAIEVSNELIIDSKKCFGCGLCVTRCPKNALSMQ
YK
Download sequence
Identical sequences A0A0C2SI32
508767.CLH_0590 gi|188588987|ref|YP_001919988.1| WP_012450556.1.10246 WP_012450556.1.14003 WP_012450556.1.16164 WP_012450556.1.17341 WP_012450556.1.1917 WP_012450556.1.31784 WP_012450556.1.32697 WP_012450556.1.43682 WP_012450556.1.47997 WP_012450556.1.53901 WP_012450556.1.58365 WP_012450556.1.64077 WP_012450556.1.64452 WP_012450556.1.65636 WP_012450556.1.73899 WP_012450556.1.87966 WP_012450556.1.92433 WP_012450556.1.92626 WP_012450556.1.9385 WP_012450556.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]