SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188589360|ref|YP_001921432.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188589360|ref|YP_001921432.1|
Domain Number 1 Region: 138-379
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.7e-87
Family Nqo1 FMN-binding domain-like 0.000000454
Further Details:      
 
Domain Number 2 Region: 466-567
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 2.75e-37
Family Nqo1C-terminal domain-like 0.00049
Further Details:      
 
Domain Number 3 Region: 380-464
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 3.14e-24
Family Nqo1 middle domain-like 0.00076
Further Details:      
 
Domain Number 4 Region: 25-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.35e-19
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0084
Further Details:      
 
Domain Number 5 Region: 572-625
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000159
Family Ferredoxin domains from multidomain proteins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188589360|ref|YP_001921432.1|
Sequence length 626
Comment putative iron hydrogenase, electron-transfer subunit [Clostridium botulinum E3 str. Alaska E43]
Sequence
MRINTREELNSSIKKCKLALGKQSKQILICGGTGCVASGSLKIYDRLKELIEQRGLEVSI
SLEDEPHDNSVGLKKSGCHGFCEMGPLLRIEPEGILYIKVKLEDCEEIVEKSIISNEVIE
HLIYKNEDRSYSKQEEIPFYARQTRVALEHCGHINAESIEEYLAADGYTAVAKALFDMTP
EEVVDEISESYLRGRGGGGFQTGRKWSQVLQQAEKQKYIVCNGDEGDPGAFMDRSMMEGD
PHRVIEGMLIAGVATKANYGYIYVRAEYPLAVKRLQMAIDQATKVGFLGKNILNSGFDFD
LHISQGAGAFVCGEGSALTASIEGNRGMPRVKPPRTVEKGLFEKPTVLNNVETFCNVPSI
INKGSKWYKSIGTEKNYGTKAFALTGNVKHTGLIEVPMGTKLKEVIFDIGGGVKEGKFKA
VQIGGPSGGCLCVGENHLELPLDFDSLKKVGAMIGSGGLVVMNDKSCMVEVARFFMNFTQ
NESCGKCIPCREGTKRMLEILTDIVEGRGTLEHLDMLEELSDTISATALCGLGKSASLPV
KSTLKYFREEYIAHVVDKKCPGGVCKSLMSYEIDKDKCKGCSKCARMCPAGAITGEIKKP
YTIDQSKCIKCGACMDGCAFKAIQLV
Download sequence
Identical sequences A0A0L9Y4X5
gi|188589360|ref|YP_001921432.1| WP_012450846.1.10246 WP_012450846.1.14003 WP_012450846.1.31784 WP_012450846.1.58365 WP_012450846.1.73899 WP_012450846.1.92626 WP_012450846.1.9385 WP_012450846.1.97908 508767.CLH_2051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]