SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188589483|ref|YP_001920962.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188589483|ref|YP_001920962.1|
Domain Number 1 Region: 448-691
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.24e-57
Family N-terminal domain of adrenodoxin reductase-like 0.00037
Further Details:      
 
Domain Number 2 Region: 355-458
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.62e-18
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0036
Further Details:      
 
Domain Number 3 Region: 780-854
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00000000011
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.059
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000381
Family Short-chain ferredoxins 0.046
Further Details:      
 
Weak hits

Sequence:  gi|188589483|ref|YP_001920962.1|
Domain Number - Region: 662-764
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00541
Family N-terminal domain of adrenodoxin reductase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188589483|ref|YP_001920962.1|
Sequence length 896
Comment pyridine nucleotide-disulfide oxidoreductase family protein [Clostridium botulinum E3 str. Alaska E43]
Sequence
MVNKKVLELANHISMKRSGSKTAITPEDPEYKILEPVVTSEMAEVGLCLELRKKKSAEEV
AVLCGKSVEETSKLLLDLAFAGACFVNEIDGVDKFWFDLWVPGQMEMIVNHPDREKIENF
KQIGEAFEGYGRKKALITAGVFSIGTGPMRVIPIETAIQGETRRASYEEISKYLNENTIF
SVSNCSCRTSREAMGEGCGHLKEDMCIQLGHAAEYYIRTGRGRKITREEAFEIIKRAEEN
GLMHQIPNADGPGNTHAICNCCGCSCYATRIAGMFQNNDMVRSNYVSKVDKDKCVACGEC
VQVCPVNALKLGQKLCTKTPIVEKKREDFAYNTEWGEDKWNVDYRINRENVVETGTSPCK
TNCPAHISVQGYIKLASQGRYKEALELIKHENPFPAVCGRICPRKCESECTRGDIDEPVA
IDEIKKFIAEQDLNKDNRYVPKLRHEYGNKIAIIGGGPSGLSCAFYLALDGYKVTVFEKQ
KVLGGMLTLGIPSYRLEKDVINAEIEILRELGVEFKVGVEVGKDVSLKYLRDQGYEAFYL
AIGAQTGRKLGVEGEDSEGVITGVDFLRNVNLGNEVKLEGNVVVIGGGNVAIDVARTATR
VGASKVNMFCLESRKEMPALDEEIQEAMDEDIEINNSWGPKKIIQENGKVVAIEFKKCIS
VFDKDRRFNPVFDENETKIVKANHILISVGQGMDWGTLLENSKIELNPNKTIKADLFTLQ
TAEPDVFAGGDALTGPKFAIDAIALGKEASISIHRYVHPGQSLVYGRDRRAYHAFDKENL
TLQGYDHIKRQKIAHIEGAKSKGTFRDLRPTFTEEQMKKETERCLGCGATTVDQDQCIGC
GACTTRCKFDAITLYRKYDAQSVTIKELKPKVIKNIIKRKFVIKARKIKKSFKRNS
Download sequence
Identical sequences WP_012450930.1.16164 WP_012450930.1.17341 WP_012450930.1.1917 WP_012450930.1.58365 WP_012450930.1.9385 WP_012450930.1.97908 508767.CLH_1574 gi|188589483|ref|YP_001920962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]