SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188589554|ref|YP_001922167.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188589554|ref|YP_001922167.1|
Domain Number 1 Region: 101-165,225-300
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.42e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 145-224
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.51e-19
Family Short-chain ferredoxins 0.054
Further Details:      
 
Domain Number 3 Region: 18-80
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188589554|ref|YP_001922167.1|
Sequence length 321
Comment sulfite reductase subunit C [Clostridium botulinum E3 str. Alaska E43]
Sequence
MDLNTKKIKKNAFRVTKVRGLTASRVRVPGGYLQADLLGKIQEISQMYGNGSVHITTRQG
FEIPGIKYEDIDKVNELLQPIIESLGINQEIPGKGYTAAGTRNVSACIGNNVCPFANYNT
TNFAKRIEKAIFPNDLHFKVALTGCPNDCIKARMHDFGIIGMTEPQYNKERCVSCGACVR
ACKKKSVDALKAVNYKVVRNEEKCIGCGECVINCPTGAWTRSKEKYYKLVIMGRSGKRNP
RLAEDFLIWADEQSIIKIILNTYKFVDKYIDRSAPGGKEHIGYIIDRVGFEEYKKWALEG
IEFPKKTIVKQCVYWNGVHFN
Download sequence
Identical sequences 508767.CLH_2790 WP_012450985.1.58365 WP_012450985.1.9385 WP_012450985.1.97908 gi|188589554|ref|YP_001922167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]