SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188589939|ref|YP_001920992.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188589939|ref|YP_001920992.1|
Domain Number 1 Region: 253-640
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 1.7e-116
Family Fe-only hydrogenase 0.0000000972
Further Details:      
 
Domain Number 2 Region: 220-289
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.72e-20
Family Short-chain ferredoxins 0.089
Further Details:      
 
Domain Number 3 Region: 34-101
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 0.0000000000012
Family Nqo1 middle domain-like 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|188589939|ref|YP_001920992.1|
Domain Number - Region: 148-214
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 0.000103
Family Nqo1C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188589939|ref|YP_001920992.1|
Sequence length 646
Comment periplasmic [Fe] hydrogenase 1 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MSCKNTTYIQSLLGSVFSTFSEDELKEITGNEKRSIAICGKINNPGIIEVPDGATLRDIL
ELCGGVVNNSSFKAAQIGIPFGGFLNESSLDKEFDFGLFYENISRAIIILSEEDCIIQYG
KFYIEYLLTKIKDGTYKNYEIVKKEITKMLKVLDRISKGVSDMRDIYILRSLAADVKDKM
HQKHNLMEEIVENFYEEIEEHIEEKKCYTAQCNHLIKLTITKKCIGCGSCKRACPVDCID
GELKKQHNIDYNKCTHCGACISACPVDAITAGNNIIKFLRDLATPNKVVITQMAPAIRVA
IGEAFGFEPGENVEKKIAAGLRKLGVDYVFDTTWGADLTIMEEAAELQERLEKYLAGDEN
VKLPILTSCCPSWIKFIENNYADMLEVPSSAKSPMQMFATIAKEIWAKEKGLSREEVTSV
AIMPCVAKIYEASRVEFSVDMNYDVDYVITTKELIKIFEKSGIDLKEIEDEEIDAVMGEY
TGAGIIFGRTGGVIEAATRTAIENMTGKRIDNIEFEGLRGWDGFRICELEVGELKLRIGV
AHGLKEAAKMLDKIRSGEEFFHAIEIMACVGGCIGGGGQPKIRKNKQQVLEKRADGLNDI
DRAKILRRSNENPEVLALYKKYLDHPLSHKAHELLHTKYFPKVKKR
Download sequence
Identical sequences 508767.CLH_1604 WP_012451281.1.58365 WP_012451281.1.9385 WP_012451281.1.97908 gi|188589939|ref|YP_001920992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]