SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590020|ref|YP_001919636.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590020|ref|YP_001919636.1|
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.43e-18
Family Short-chain ferredoxins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188590020|ref|YP_001919636.1|
Sequence length 56
Comment hypothetical protein CLH_0200 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MAFVINDSCVSCGACAGECPVDAISQGDAYYVIDADTCIDCGNCANVCPVGAPVQE
Download sequence
Identical sequences A0A093VRU3 A0A1R6LLX2 B2TIE0 C5UU44
508765.CLL_A0202 508767.CLH_0200 gi|188590020|ref|YP_001919636.1| WP_003369634.1.10246 WP_003369634.1.14003 WP_003369634.1.14250 WP_003369634.1.16164 WP_003369634.1.17341 WP_003369634.1.1917 WP_003369634.1.31784 WP_003369634.1.32697 WP_003369634.1.40399 WP_003369634.1.43682 WP_003369634.1.45387 WP_003369634.1.47997 WP_003369634.1.49945 WP_003369634.1.50906 WP_003369634.1.53901 WP_003369634.1.54004 WP_003369634.1.55913 WP_003369634.1.58365 WP_003369634.1.64077 WP_003369634.1.64452 WP_003369634.1.65636 WP_003369634.1.73899 WP_003369634.1.87966 WP_003369634.1.88993 WP_003369634.1.92433 WP_003369634.1.92626 WP_003369634.1.9385 WP_003369634.1.97908 gi|187934556|ref|YP_001884438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]