SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590043|ref|YP_001921250.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590043|ref|YP_001921250.1|
Domain Number 1 Region: 102-275
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.27e-18
Family MoCo biosynthesis proteins 0.053
Further Details:      
 
Domain Number 2 Region: 25-114
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000669
Family Short-chain ferredoxins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188590043|ref|YP_001921250.1|
Sequence length 313
Comment glycyl-radical enzyme activating protein family [Clostridium botulinum E3 str. Alaska E43]
Sequence
MDKNKGLIFDIQSYSVHDGPGCRTTCFFSGCFLKCEWCANPESWTKKEKIMFAEGKCKHD
QGCNRCEKACEKKAISFKDDNSLNVDWKVCENCTSFECAKVCYNEALRICGKNYTVDSLL
KILNRDRQFWGSNGGVTFSGGEPFYQSEFLISTLKKCKEMYINTAIETTAFVDTNTFLEG
MKYVDFAFIDIKHMDREKHKEKTGAYNDLILKNIKELINSNWQGRLVIRMPVIRDFNDTV
ENAMATADFMNDLGIYEINLLPFHRMGDSKWTQLGKKYSYSNDEPTSEDKLDELQDIYLD
RKIACYIGSETSF
Download sequence
Identical sequences WP_012451357.1.31784 WP_012451357.1.47997 WP_012451357.1.53901 WP_012451357.1.58365 WP_012451357.1.9385 WP_012451357.1.97908 gi|188590043|ref|YP_001921250.1| 508767.CLH_1869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]