SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590215|ref|YP_001919784.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590215|ref|YP_001919784.1|
Domain Number 1 Region: 70-253
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3e-54
Family ETFP subunits 0.0032
Further Details:      
 
Domain Number 2 Region: 270-390
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.8e-44
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00025
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000103
Family Ferredoxin domains from multidomain proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188590215|ref|YP_001919784.1|
Sequence length 396
Comment electron transfer flavoprotein, alpha subunit/FixB family protein [Clostridium botulinum E3 str. Alaska E43]
Sequence
MAKLVVNQEKITNKKELIKICPFGALEINDGKVEINGACKMCKLCVKKGPKGAIEYIEEE
VKSIDKDLWKGISVYVDHVNGKIHPVTYELIGKARELAAKINHPVYCVFIGHKVSEEAKE
LLHYGVNKVFVYDDEELKDFRIEPYAAAFEDFIKNVKPSSILVGATTIGRSLAPRMAARF
RTGLTADCTILDIKEDTDLVQIRPAFGGNIMAQIVTPNSRPQLATVRYKVMTAPERTDDV
NGEIIKCDIKKDKLKSGINVLEIKEKNTEVGISDAEVIVAAGRGIKSEKDLAMIKEFAEL
LGAEFACTRPLIESGWVDAKRQIGLSGRTVRPRLIITCGISGAVQFSAGMNNSEHIFAIN
NDDKAPIFKVAHYGVVGNIYEIIPQLIEKIKMSKEA
Download sequence
Identical sequences A0A0C2SHJ0
508767.CLH_0349 gi|188590215|ref|YP_001919784.1| WP_012451489.1.10246 WP_012451489.1.14003 WP_012451489.1.47997 WP_012451489.1.58365 WP_012451489.1.65636 WP_012451489.1.73899 WP_012451489.1.92433 WP_012451489.1.92626 WP_012451489.1.9385 WP_012451489.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]