SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590495|ref|YP_001921441.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590495|ref|YP_001921441.1|
Domain Number 1 Region: 5-321
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.66e-67
Family FMN-linked oxidoreductases 0.00000464
Further Details:      
 
Domain Number 2 Region: 311-395
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.3e-24
Family Ferredoxin domains from multidomain proteins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188590495|ref|YP_001921441.1|
Sequence length 412
Comment dihydropyrimidine dehydrogenase [Clostridium botulinum E3 str. Alaska E43]
Sequence
MSIIKDLSIEFCGVKCENPFFLSSSPVGNCYEMCAKAFEAGWGGVMFKTIGFFMPNEVSP
RFDSLRKEATSFVGFKNMEQISDHPLQQNLDDLRRLKENYPTKIVVASIMGENEKEWEDL
AKLVTEAGADMIECNFSCPQMTSHEMGSDVGQNPELVKKYCEATRRGTNLPILAKMTPNI
GDMSVPAIASMEGGATGLATINTIKSITGIDINSMTAKPVVNAKSSVSGYSGKAVKPIAL
RFIYELAKNEKLKGVPISGIGGIETWEDALEFILLGSSNLQVTTSVMQYGYRVVEDMISG
LSHFMDENGFEKLEDMVGIAIKNIIPAEDLDREYIVYPEVNEEKCLGCGRCYISCYDGAH
QAIKWNSEERKPEVNKDRCVGCHLCALVCPVTAIGKGEIKFKNNGKEREIIL
Download sequence
Identical sequences A0A0C2SG09
WP_012451722.1.10246 WP_012451722.1.14003 WP_012451722.1.16164 WP_012451722.1.17341 WP_012451722.1.1917 WP_012451722.1.31784 WP_012451722.1.32697 WP_012451722.1.43682 WP_012451722.1.47997 WP_012451722.1.53901 WP_012451722.1.58365 WP_012451722.1.64077 WP_012451722.1.64452 WP_012451722.1.65636 WP_012451722.1.73899 WP_012451722.1.87966 WP_012451722.1.92433 WP_012451722.1.92626 WP_012451722.1.9385 WP_012451722.1.97908 508767.CLH_2060 gi|188590495|ref|YP_001921441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]