SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590707|ref|YP_001919560.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590707|ref|YP_001919560.1|
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000345
Family Single 4Fe-4S cluster ferredoxin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188590707|ref|YP_001919560.1|
Sequence length 62
Comment hypothetical protein CLH_0106 [Clostridium botulinum E3 str. Alaska E43]
Sequence
MKANVDKDTCIGCGLCPSICPECFDMQDDGKAGVIVPEVPSACQDSAKEAETSCPVNAIS
VE
Download sequence
Identical sequences A0A093YQM6 C5UUR0
WP_003372764.1.10246 WP_003372764.1.14003 WP_003372764.1.14250 WP_003372764.1.16164 WP_003372764.1.17341 WP_003372764.1.1917 WP_003372764.1.31784 WP_003372764.1.32697 WP_003372764.1.40399 WP_003372764.1.43682 WP_003372764.1.47997 WP_003372764.1.50906 WP_003372764.1.53901 WP_003372764.1.54004 WP_003372764.1.58365 WP_003372764.1.64077 WP_003372764.1.64452 WP_003372764.1.65636 WP_003372764.1.73899 WP_003372764.1.87966 WP_003372764.1.88993 WP_003372764.1.92433 WP_003372764.1.92626 WP_003372764.1.9385 WP_003372764.1.97908 gi|188590707|ref|YP_001919560.1| 508767.CLH_0106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]