SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188590775|ref|YP_001921048.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188590775|ref|YP_001921048.1|
Domain Number 1 Region: 9-151
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.92e-22
Family Short-chain ferredoxins 0.028
Further Details:      
 
Domain Number 2 Region: 93-270
Classification Level Classification E-value
Superfamily Radical SAM enzymes 6.87e-22
Family MoCo biosynthesis proteins 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188590775|ref|YP_001921048.1|
Sequence length 310
Comment glycyl-radical enzyme activating family protein [Clostridium botulinum E3 str. Alaska E43]
Sequence
MLKNEVDLNKMGTVFNIQRFSVNDGPGIRTIVFLKGCPLSCHWCSNPESQNVNKQLLFNI
KNCTGCHKCKTICEYDAIDLNNFNRIDRDKCISCGKCAENCYPGALVVSGKEMSVKEVLD
ELNKDSSQFRRSNGGVTLSGGEPLLQHEFALEILKGCKSIGIHTTIETTGYVDKEILRKI
APWVDLVLLDIKTLNEDKHIKYVGASNKIILENAKSISELVTSTIIRVPVIPQFNCDEKS
IQDIAKFTKSLNNITEIHLLPYHKLGLNKYDCLGKEYLMKNDINTPSEEVMLNFKKIVED
IGLTCNIGAN
Download sequence
Identical sequences A0A0C2N235
508767.CLH_1662 WP_012451937.1.10246 WP_012451937.1.14003 WP_012451937.1.16164 WP_012451937.1.17341 WP_012451937.1.1917 WP_012451937.1.31784 WP_012451937.1.32697 WP_012451937.1.43682 WP_012451937.1.47997 WP_012451937.1.53901 WP_012451937.1.58365 WP_012451937.1.64077 WP_012451937.1.64452 WP_012451937.1.65636 WP_012451937.1.73899 WP_012451937.1.87966 WP_012451937.1.92433 WP_012451937.1.92626 WP_012451937.1.9385 WP_012451937.1.97908 gi|188590775|ref|YP_001921048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]