SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198242189|ref|YP_002214242.1| from Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198242189|ref|YP_002214242.1|
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.3e-40
Family PA0094-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198242189|ref|YP_002214242.1|
Sequence length 148
Comment hypothetical protein SeD_A0311 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
Sequence
MDRPYRIQEGGFVLPETFTDRSVNIFILEGNERTSPSLNISRDTLKPDEDLPAYIDRQIA
LMKKNLGQHRVLSRAPAQAGTGNDALMGEQIAATHKSGKTEVYQRQAGFIATPGKVLVFT
LTSPRPFDDKADLLWNTWLAGFQPDKNE
Download sequence
Identical sequences A0A2G1P0I1 M7RXZ1
CP001144|CDS_331368-331814 gi|198242189|ref|YP_002214242.1| 439851.SeD_A0311 WP_000375834.1.100017 WP_000375834.1.101927 WP_000375834.1.1239 WP_000375834.1.15214 WP_000375834.1.20767 WP_000375834.1.21616 WP_000375834.1.22590 WP_000375834.1.24803 WP_000375834.1.25421 WP_000375834.1.2568 WP_000375834.1.25709 WP_000375834.1.26532 WP_000375834.1.26587 WP_000375834.1.2910 WP_000375834.1.29274 WP_000375834.1.3067 WP_000375834.1.31983 WP_000375834.1.33865 WP_000375834.1.34684 WP_000375834.1.35332 WP_000375834.1.35619 WP_000375834.1.3572 WP_000375834.1.3726 WP_000375834.1.39414 WP_000375834.1.39614 WP_000375834.1.40158 WP_000375834.1.40284 WP_000375834.1.4141 WP_000375834.1.41434 WP_000375834.1.44397 WP_000375834.1.4592 WP_000375834.1.48268 WP_000375834.1.50905 WP_000375834.1.54469 WP_000375834.1.55853 WP_000375834.1.56950 WP_000375834.1.58749 WP_000375834.1.59335 WP_000375834.1.62245 WP_000375834.1.64121 WP_000375834.1.66122 WP_000375834.1.66289 WP_000375834.1.66937 WP_000375834.1.70303 WP_000375834.1.70929 WP_000375834.1.70977 WP_000375834.1.71600 WP_000375834.1.72182 WP_000375834.1.72470 WP_000375834.1.72625 WP_000375834.1.73764 WP_000375834.1.77067 WP_000375834.1.79757 WP_000375834.1.80609 WP_000375834.1.81455 WP_000375834.1.8425 WP_000375834.1.86159 WP_000375834.1.86240 WP_000375834.1.87760 WP_000375834.1.87936 WP_000375834.1.88982 WP_000375834.1.92754 WP_000375834.1.93410 WP_000375834.1.94983 WP_000375834.1.95558 WP_000375834.1.96490 WP_000375834.1.96584 WP_000375834.1.99577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]