SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198244215|ref|YP_002217539.1| from Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|198244215|ref|YP_002217539.1|
Domain Number - Region: 52-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.00513
Family PA0094-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198244215|ref|YP_002217539.1|
Sequence length 185
Comment hypothetical protein SeD_A3952 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
Sequence
MRNLVKYAGIGLLVMGLAACDNNDTKASAESAAAESQASGQPISLMDGKLSFSLPADMTD
QSGKLGTQANNMHVYSDPTGQKAVIVIVGDNTDEALPVLANRLLEQQRSRDPQLQVVTNK
SIELKGHTLQQLDSIISAKGQTAYSSIVLGKVDNQLLTIQVTLPADNQQKAQTTAENIIN
TLVIK
Download sequence
Identical sequences A0A0F5BAQ8 A0A0F6B848 A0A0F7JB00 A0A0G2NTC7 A0A0H2WTF1 A0A0H3BW85 A0A0H3NIT6 A0A0J5EW41 A0A0L9F485 A0A0M0QBQ7 A0A0N1R1B1 A0A0R9NLU9 A0A0U1JXE5 A0A0V2DD77 A0A1R3C774 A0A1S1AVE3 A0A1X2RRN3 A0A1X2UXX1 A0A221Z7M1 A0A249UT52 A0A265BAD0 A0A267SJD4 A0A271CGF0 A0A2C6GF37 A0A2D1X8Z7 A0A2D3TRC2 A0A2G1NM67 A0A2H9YLI6 A0A2I6MGB4 A0A2I6MU67 A0A2I6NYW7 A0A2K2ZGE5 B5F9E2 B5RGU6 C0Q134 E8XF92 G5LFG9 G5NJF4 G5PTZ8 G5Q925 G5QZI4 G5RM21 G5S2A3 G5SHY6 M7RHF1 Q57IP7 Q7CPJ3 Q8XFQ6 S4J4C0 S5HQP3 V7IU64 V7V2J6
gi|525840307|ref|YP_008257805.1| gi|525814849|ref|YP_008244867.1| gi|526218500|ref|YP_008263674.1| gi|161616628|ref|YP_001590593.1| gi|528817027|ref|YP_008358230.1| APC24034 gi|378962117|ref|YP_005219603.1| gi|205354802|ref|YP_002228603.1| gi|525828691|ref|YP_008251636.1| gi|194738145|ref|YP_002116515.1| gi|378452432|ref|YP_005239792.1| NP_458341.1.84458 NP_462481.1.58477 WP_001245277.1.100002 WP_001245277.1.100007 WP_001245277.1.100008 WP_001245277.1.100010 WP_001245277.1.100017 WP_001245277.1.100031 WP_001245277.1.100036 WP_001245277.1.100077 WP_001245277.1.100079 WP_001245277.1.100115 WP_001245277.1.10013 WP_001245277.1.100137 WP_001245277.1.100149 WP_001245277.1.100165 WP_001245277.1.100191 WP_001245277.1.100196 WP_001245277.1.1002 WP_001245277.1.100234 WP_001245277.1.100258 WP_001245277.1.100284 WP_001245277.1.100313 WP_001245277.1.100314 WP_001245277.1.100321 WP_001245277.1.100354 WP_001245277.1.100376 WP_001245277.1.100392 WP_001245277.1.100412 WP_001245277.1.100413 WP_001245277.1.100421 WP_001245277.1.100424 WP_001245277.1.100432 WP_001245277.1.100438 WP_001245277.1.100446 WP_001245277.1.100450 WP_001245277.1.100457 WP_001245277.1.100472 WP_001245277.1.100484 WP_001245277.1.100488 WP_001245277.1.100502 WP_001245277.1.100519 WP_001245277.1.100521 WP_001245277.1.100541 WP_001245277.1.100557 WP_001245277.1.100589 WP_001245277.1.100592 WP_001245277.1.100597 WP_001245277.1.100605 WP_001245277.1.100610 WP_001245277.1.10065 WP_001245277.1.100650 WP_001245277.1.100707 WP_001245277.1.100711 WP_001245277.1.100721 WP_001245277.1.100730 WP_001245277.1.100732 WP_001245277.1.100733 WP_001245277.1.100739 WP_001245277.1.10076 WP_001245277.1.100764 WP_001245277.1.100773 WP_001245277.1.100776 WP_001245277.1.100781 WP_001245277.1.100790 WP_001245277.1.100793 WP_001245277.1.100799 WP_001245277.1.10081 WP_001245277.1.100857 WP_001245277.1.100865 WP_001245277.1.100869 WP_001245277.1.100870 WP_001245277.1.100871 WP_001245277.1.100882 WP_001245277.1.100886 WP_001245277.1.100895 WP_001245277.1.100941 WP_001245277.1.100948 WP_001245277.1.100953 WP_001245277.1.101007 WP_001245277.1.101011 WP_001245277.1.101020 WP_001245277.1.101042 WP_001245277.1.101074 WP_001245277.1.101078 WP_001245277.1.10108 WP_001245277.1.101091 WP_001245277.1.101094 WP_001245277.1.101111 WP_001245277.1.101112 WP_001245277.1.101123 WP_001245277.1.101126 WP_001245277.1.101147 WP_001245277.1.101180 WP_001245277.1.101185 WP_001245277.1.101199 WP_001245277.1.101223 WP_001245277.1.101226 WP_001245277.1.10124 WP_001245277.1.101259 WP_001245277.1.101271 WP_001245277.1.101284 WP_001245277.1.101291 WP_001245277.1.1013 WP_001245277.1.101312 WP_001245277.1.101320 WP_001245277.1.101322 WP_001245277.1.101353 WP_001245277.1.101374 WP_001245277.1.101386 WP_001245277.1.101404 WP_001245277.1.101420 WP_001245277.1.101454 WP_001245277.1.101473 WP_001245277.1.101520 WP_001245277.1.101541 WP_001245277.1.101589 WP_001245277.1.101616 WP_001245277.1.101634 WP_001245277.1.101636 WP_001245277.1.101639 WP_001245277.1.10164 WP_001245277.1.101674 WP_001245277.1.101707 WP_001245277.1.101724 WP_001245277.1.101734 WP_001245277.1.101740 WP_001245277.1.101744 WP_001245277.1.101759 WP_001245277.1.10177 WP_001245277.1.101776 WP_001245277.1.101815 WP_001245277.1.101832 WP_001245277.1.101841 WP_001245277.1.101868 WP_001245277.1.101878 WP_001245277.1.101890 WP_001245277.1.10191 WP_001245277.1.101917 WP_001245277.1.101927 WP_001245277.1.101941 WP_001245277.1.101953 WP_001245277.1.101975 WP_001245277.1.102009 WP_001245277.1.102050 WP_001245277.1.102087 WP_001245277.1.102103 WP_001245277.1.102111 WP_001245277.1.10220 WP_001245277.1.10231 WP_001245277.1.10237 WP_001245277.1.10266 WP_001245277.1.10300 WP_001245277.1.10310 WP_001245277.1.10338 WP_001245277.1.1038 WP_001245277.1.10394 WP_001245277.1.104 WP_001245277.1.10401 WP_001245277.1.10428 WP_001245277.1.10429 WP_001245277.1.10439 WP_001245277.1.10459 WP_001245277.1.10463 WP_001245277.1.10465 WP_001245277.1.10475 WP_001245277.1.10498 WP_001245277.1.10507 WP_001245277.1.10511 WP_001245277.1.10514 WP_001245277.1.10521 WP_001245277.1.10530 WP_001245277.1.10532 WP_001245277.1.10547 WP_001245277.1.10562 WP_001245277.1.10566 WP_001245277.1.10595 WP_001245277.1.10631 WP_001245277.1.10642 WP_001245277.1.10654 WP_001245277.1.10675 WP_001245277.1.10677 WP_001245277.1.10678 WP_001245277.1.10711 WP_001245277.1.10753 WP_001245277.1.10755 WP_001245277.1.10797 WP_001245277.1.10857 WP_001245277.1.10868 WP_001245277.1.10873 WP_001245277.1.10898 WP_001245277.1.10926 WP_001245277.1.10936 WP_001245277.1.10992 WP_001245277.1.11000 WP_001245277.1.11012 WP_001245277.1.11024 WP_001245277.1.11031 WP_001245277.1.11055 WP_001245277.1.11098 WP_001245277.1.1110 WP_001245277.1.11119 WP_001245277.1.11126 WP_001245277.1.11142 WP_001245277.1.11156 WP_001245277.1.11168 WP_001245277.1.11190 WP_001245277.1.11213 WP_001245277.1.11216 WP_001245277.1.11239 WP_001245277.1.11253 WP_001245277.1.11295 WP_001245277.1.11314 WP_001245277.1.1135 WP_001245277.1.11362 WP_001245277.1.1137 WP_001245277.1.11385 WP_001245277.1.11405 WP_001245277.1.1142 WP_001245277.1.11426 WP_001245277.1.11429 WP_001245277.1.11455 WP_001245277.1.11458 WP_001245277.1.1150 WP_001245277.1.11518 WP_001245277.1.11526 WP_001245277.1.11528 WP_001245277.1.11532 WP_001245277.1.11543 WP_001245277.1.11544 WP_001245277.1.11557 WP_001245277.1.1156 WP_001245277.1.11567 WP_001245277.1.11588 WP_001245277.1.11621 WP_001245277.1.11638 WP_001245277.1.11677 WP_001245277.1.11681 WP_001245277.1.11687 WP_001245277.1.1169 WP_001245277.1.11735 WP_001245277.1.1174 WP_001245277.1.11763 WP_001245277.1.11772 WP_001245277.1.11810 WP_001245277.1.11824 WP_001245277.1.11834 WP_001245277.1.11841 WP_001245277.1.11865 WP_001245277.1.11868 WP_001245277.1.11883 WP_001245277.1.11897 WP_001245277.1.11900 WP_001245277.1.11908 WP_001245277.1.11914 WP_001245277.1.11936 WP_001245277.1.11938 WP_001245277.1.11964 WP_001245277.1.11978 WP_001245277.1.12007 WP_001245277.1.12017 WP_001245277.1.12025 WP_001245277.1.12027 WP_001245277.1.12040 WP_001245277.1.12047 WP_001245277.1.12059 WP_001245277.1.12061 WP_001245277.1.12063 WP_001245277.1.1207 WP_001245277.1.12106 WP_001245277.1.12114 WP_001245277.1.12141 WP_001245277.1.12144 WP_001245277.1.1215 WP_001245277.1.12160 WP_001245277.1.12168 WP_001245277.1.12172 WP_001245277.1.12192 WP_001245277.1.12210 WP_001245277.1.1224 WP_001245277.1.12244 WP_001245277.1.12308 WP_001245277.1.12340 WP_001245277.1.12351 WP_001245277.1.12364 WP_001245277.1.12370 WP_001245277.1.12374 WP_001245277.1.1239 WP_001245277.1.12396 WP_001245277.1.12398 WP_001245277.1.12441 WP_001245277.1.12456 WP_001245277.1.12484 WP_001245277.1.12485 WP_001245277.1.1250 WP_001245277.1.12517 WP_001245277.1.12546 WP_001245277.1.12568 WP_001245277.1.12569 WP_001245277.1.12581 WP_001245277.1.12584 WP_001245277.1.12585 WP_001245277.1.12620 WP_001245277.1.1264 WP_001245277.1.12648 WP_001245277.1.12650 WP_001245277.1.12683 WP_001245277.1.12696 WP_001245277.1.12701 WP_001245277.1.12718 WP_001245277.1.12726 WP_001245277.1.12727 WP_001245277.1.12728 WP_001245277.1.12741 WP_001245277.1.12834 WP_001245277.1.12865 WP_001245277.1.12877 WP_001245277.1.12879 WP_001245277.1.12936 WP_001245277.1.12995 WP_001245277.1.1300 WP_001245277.1.13027 WP_001245277.1.13076 WP_001245277.1.13101 WP_001245277.1.13102 WP_001245277.1.13106 WP_001245277.1.13108 WP_001245277.1.13130 WP_001245277.1.13161 WP_001245277.1.13207 WP_001245277.1.1321 WP_001245277.1.13247 WP_001245277.1.1326 WP_001245277.1.13262 WP_001245277.1.13268 WP_001245277.1.13274 WP_001245277.1.13291 WP_001245277.1.133 WP_001245277.1.13311 WP_001245277.1.13314 WP_001245277.1.13334 WP_001245277.1.13338 WP_001245277.1.13342 WP_001245277.1.13352 WP_001245277.1.13367 WP_001245277.1.13391 WP_001245277.1.13406 WP_001245277.1.13414 WP_001245277.1.13429 WP_001245277.1.13440 WP_001245277.1.13443 WP_001245277.1.1346 WP_001245277.1.13476 WP_001245277.1.13488 WP_001245277.1.13509 WP_001245277.1.13528 WP_001245277.1.13573 WP_001245277.1.13599 WP_001245277.1.13602 WP_001245277.1.13625 WP_001245277.1.13661 WP_001245277.1.13669 WP_001245277.1.13677 WP_001245277.1.13686 WP_001245277.1.1372 WP_001245277.1.13732 WP_001245277.1.13741 WP_001245277.1.13819 WP_001245277.1.1382 WP_001245277.1.13827 WP_001245277.1.13829 WP_001245277.1.1387 WP_001245277.1.13908 WP_001245277.1.13932 WP_001245277.1.13967 WP_001245277.1.13968 WP_001245277.1.1397 WP_001245277.1.13972 WP_001245277.1.140 WP_001245277.1.14001 WP_001245277.1.1401 WP_001245277.1.14011 WP_001245277.1.14041 WP_001245277.1.14050 WP_001245277.1.14056 WP_001245277.1.1408 WP_001245277.1.14089 WP_001245277.1.14099 WP_001245277.1.14111 WP_001245277.1.1412 WP_001245277.1.14120 WP_001245277.1.14123 WP_001245277.1.14150 WP_001245277.1.14151 WP_001245277.1.14191 WP_001245277.1.14197 WP_001245277.1.14212 WP_001245277.1.14239 WP_001245277.1.14280 WP_001245277.1.14286 WP_001245277.1.14296 WP_001245277.1.14320 WP_001245277.1.14333 WP_001245277.1.14379 WP_001245277.1.14399 WP_001245277.1.1440 WP_001245277.1.14406 WP_001245277.1.14410 WP_001245277.1.14436 WP_001245277.1.14444 WP_001245277.1.14446 WP_001245277.1.14458 WP_001245277.1.14466 WP_001245277.1.14467 WP_001245277.1.14474 WP_001245277.1.14500 WP_001245277.1.14505 WP_001245277.1.14516 WP_001245277.1.14519 WP_001245277.1.14524 WP_001245277.1.14526 WP_001245277.1.14528 WP_001245277.1.14550 WP_001245277.1.14554 WP_001245277.1.14575 WP_001245277.1.146 WP_001245277.1.14618 WP_001245277.1.14688 WP_001245277.1.14701 WP_001245277.1.14703 WP_001245277.1.14706 WP_001245277.1.14708 WP_001245277.1.14719 WP_001245277.1.14725 WP_001245277.1.1473 WP_001245277.1.14737 WP_001245277.1.14765 WP_001245277.1.14793 WP_001245277.1.14808 WP_001245277.1.14810 WP_001245277.1.14819 WP_001245277.1.14852 WP_001245277.1.14876 WP_001245277.1.14877 WP_001245277.1.1489 WP_001245277.1.14894 WP_001245277.1.14913 WP_001245277.1.14917 WP_001245277.1.14927 WP_001245277.1.14930 WP_001245277.1.14932 WP_001245277.1.14947 WP_001245277.1.14948 WP_001245277.1.15011 WP_001245277.1.15046 WP_001245277.1.15054 WP_001245277.1.15055 WP_001245277.1.15059 WP_001245277.1.15067 WP_001245277.1.15079 WP_001245277.1.15100 WP_001245277.1.15124 WP_001245277.1.15184 WP_001245277.1.15214 WP_001245277.1.15223 WP_001245277.1.15226 WP_001245277.1.15244 WP_001245277.1.15265 WP_001245277.1.15276 WP_001245277.1.15316 WP_001245277.1.15318 WP_001245277.1.15353 WP_001245277.1.15362 WP_001245277.1.15369 WP_001245277.1.1540 WP_001245277.1.15415 WP_001245277.1.15423 WP_001245277.1.15433 WP_001245277.1.15439 WP_001245277.1.15468 WP_001245277.1.15479 WP_001245277.1.15483 WP_001245277.1.15487 WP_001245277.1.15508 WP_001245277.1.1551 WP_001245277.1.15535 WP_001245277.1.15581 WP_001245277.1.15585 WP_001245277.1.15586 WP_001245277.1.15597 WP_001245277.1.15625 WP_001245277.1.15627 WP_001245277.1.15637 WP_001245277.1.15644 WP_001245277.1.1568 WP_001245277.1.15708 WP_001245277.1.15710 WP_001245277.1.15717 WP_001245277.1.15775 WP_001245277.1.15777 WP_001245277.1.15784 WP_001245277.1.158 WP_001245277.1.15830 WP_001245277.1.15835 WP_001245277.1.15862 WP_001245277.1.15881 WP_001245277.1.15905 WP_001245277.1.15909 WP_001245277.1.15910 WP_001245277.1.15912 WP_001245277.1.1592 WP_001245277.1.15922 WP_001245277.1.15938 WP_001245277.1.15970 WP_001245277.1.15978 WP_001245277.1.15986 WP_001245277.1.16004 WP_001245277.1.16006 WP_001245277.1.1601 WP_001245277.1.16032 WP_001245277.1.16046 WP_001245277.1.16047 WP_001245277.1.16051 WP_001245277.1.16052 WP_001245277.1.16058 WP_001245277.1.16062 WP_001245277.1.16063 WP_001245277.1.16103 WP_001245277.1.1611 WP_001245277.1.16125 WP_001245277.1.16150 WP_001245277.1.16155 WP_001245277.1.16158 WP_001245277.1.16166 WP_001245277.1.16233 WP_001245277.1.16244 WP_001245277.1.1626 WP_001245277.1.16264 WP_001245277.1.16273 WP_001245277.1.16284 WP_001245277.1.16328 WP_001245277.1.16331 WP_001245277.1.16344 WP_001245277.1.1635 WP_001245277.1.16361 WP_001245277.1.16363 WP_001245277.1.16365 WP_001245277.1.16366 WP_001245277.1.16394 WP_001245277.1.16452 WP_001245277.1.16453 WP_001245277.1.16461 WP_001245277.1.16462 WP_001245277.1.16465 WP_001245277.1.16468 WP_001245277.1.16474 WP_001245277.1.16508 WP_001245277.1.16522 WP_001245277.1.16525 WP_001245277.1.16551 WP_001245277.1.16565 WP_001245277.1.16581 WP_001245277.1.16588 WP_001245277.1.16614 WP_001245277.1.16650 WP_001245277.1.16656 WP_001245277.1.16658 WP_001245277.1.16666 WP_001245277.1.16673 WP_001245277.1.1668 WP_001245277.1.16686 WP_001245277.1.16691 WP_001245277.1.167 WP_001245277.1.16710 WP_001245277.1.16729 WP_001245277.1.16732 WP_001245277.1.16735 WP_001245277.1.16736 WP_001245277.1.1674 WP_001245277.1.16767 WP_001245277.1.16781 WP_001245277.1.16786 WP_001245277.1.16804 WP_001245277.1.16819 WP_001245277.1.16826 WP_001245277.1.16855 WP_001245277.1.16858 WP_001245277.1.16873 WP_001245277.1.16879 WP_001245277.1.16893 WP_001245277.1.16896 WP_001245277.1.16903 WP_001245277.1.16905 WP_001245277.1.16910 WP_001245277.1.16916 WP_001245277.1.16941 WP_001245277.1.16942 WP_001245277.1.16944 WP_001245277.1.16948 WP_001245277.1.16949 WP_001245277.1.16965 WP_001245277.1.16972 WP_001245277.1.1700 WP_001245277.1.17031 WP_001245277.1.17049 WP_001245277.1.17058 WP_001245277.1.17060 WP_001245277.1.17078 WP_001245277.1.17093 WP_001245277.1.17098 WP_001245277.1.17105 WP_001245277.1.17188 WP_001245277.1.17202 WP_001245277.1.17219 WP_001245277.1.1722 WP_001245277.1.17270 WP_001245277.1.17285 WP_001245277.1.17302 WP_001245277.1.17307 WP_001245277.1.17308 WP_001245277.1.1733 WP_001245277.1.17368 WP_001245277.1.1737 WP_001245277.1.17390 WP_001245277.1.174 WP_001245277.1.17405 WP_001245277.1.17406 WP_001245277.1.17439 WP_001245277.1.17447 WP_001245277.1.17480 WP_001245277.1.17482 WP_001245277.1.17504 WP_001245277.1.17513 WP_001245277.1.17525 WP_001245277.1.17543 WP_001245277.1.17546 WP_001245277.1.17560 WP_001245277.1.17563 WP_001245277.1.1757 WP_001245277.1.17578 WP_001245277.1.17583 WP_001245277.1.17622 WP_001245277.1.17629 WP_001245277.1.17659 WP_001245277.1.17667 WP_001245277.1.17686 WP_001245277.1.17702 WP_001245277.1.17703 WP_001245277.1.17705 WP_001245277.1.17732 WP_001245277.1.17741 WP_001245277.1.17743 WP_001245277.1.17747 WP_001245277.1.17758 WP_001245277.1.17840 WP_001245277.1.17886 WP_001245277.1.17891 WP_001245277.1.17901 WP_001245277.1.17914 WP_001245277.1.17919 WP_001245277.1.17936 WP_001245277.1.17949 WP_001245277.1.17956 WP_001245277.1.1798 WP_001245277.1.17991 WP_001245277.1.18005 WP_001245277.1.1801 WP_001245277.1.18019 WP_001245277.1.18021 WP_001245277.1.18022 WP_001245277.1.18056 WP_001245277.1.18061 WP_001245277.1.1807 WP_001245277.1.18092 WP_001245277.1.18099 WP_001245277.1.18109 WP_001245277.1.18111 WP_001245277.1.18122 WP_001245277.1.18124 WP_001245277.1.18144 WP_001245277.1.18149 WP_001245277.1.18163 WP_001245277.1.18173 WP_001245277.1.18177 WP_001245277.1.1818 WP_001245277.1.18192 WP_001245277.1.18249 WP_001245277.1.1825 WP_001245277.1.18254 WP_001245277.1.18265 WP_001245277.1.18267 WP_001245277.1.18270 WP_001245277.1.18277 WP_001245277.1.18280 WP_001245277.1.18281 WP_001245277.1.18282 WP_001245277.1.18328 WP_001245277.1.18355 WP_001245277.1.18358 WP_001245277.1.18370 WP_001245277.1.18384 WP_001245277.1.18406 WP_001245277.1.18426 WP_001245277.1.18441 WP_001245277.1.18445 WP_001245277.1.18468 WP_001245277.1.18474 WP_001245277.1.18485 WP_001245277.1.18513 WP_001245277.1.18607 WP_001245277.1.18610 WP_001245277.1.18641 WP_001245277.1.18678 WP_001245277.1.18686 WP_001245277.1.18692 WP_001245277.1.18705 WP_001245277.1.18715 WP_001245277.1.18722 WP_001245277.1.18737 WP_001245277.1.18766 WP_001245277.1.18776 WP_001245277.1.1880 WP_001245277.1.18822 WP_001245277.1.18847 WP_001245277.1.1885 WP_001245277.1.18860 WP_001245277.1.18881 WP_001245277.1.18886 WP_001245277.1.18895 WP_001245277.1.18919 WP_001245277.1.18922 WP_001245277.1.18940 WP_001245277.1.18949 WP_001245277.1.1895 WP_001245277.1.18959 WP_001245277.1.1897 WP_001245277.1.18972 WP_001245277.1.19001 WP_001245277.1.19006 WP_001245277.1.19030 WP_001245277.1.19038 WP_001245277.1.19044 WP_001245277.1.19053 WP_001245277.1.19055 WP_001245277.1.19084 WP_001245277.1.19093 WP_001245277.1.19163 WP_001245277.1.19174 WP_001245277.1.19187 WP_001245277.1.19228 WP_001245277.1.19240 WP_001245277.1.19273 WP_001245277.1.19288 WP_001245277.1.19300 WP_001245277.1.19320 WP_001245277.1.19340 WP_001245277.1.19357 WP_001245277.1.19373 WP_001245277.1.1939 WP_001245277.1.19405 WP_001245277.1.19422 WP_001245277.1.19433 WP_001245277.1.19454 WP_001245277.1.19456 WP_001245277.1.19458 WP_001245277.1.19460 WP_001245277.1.19461 WP_001245277.1.19469 WP_001245277.1.19496 WP_001245277.1.19535 WP_001245277.1.19538 WP_001245277.1.1955 WP_001245277.1.19588 WP_001245277.1.19589 WP_001245277.1.19614 WP_001245277.1.19616 WP_001245277.1.19642 WP_001245277.1.19656 WP_001245277.1.19660 WP_001245277.1.19663 WP_001245277.1.1968 WP_001245277.1.19683 WP_001245277.1.19686 WP_001245277.1.19702 WP_001245277.1.19706 WP_001245277.1.19723 WP_001245277.1.19724 WP_001245277.1.19731 WP_001245277.1.19740 WP_001245277.1.19749 WP_001245277.1.19784 WP_001245277.1.19793 WP_001245277.1.19794 WP_001245277.1.19802 WP_001245277.1.19809 WP_001245277.1.19823 WP_001245277.1.19834 WP_001245277.1.19867 WP_001245277.1.19882 WP_001245277.1.1990 WP_001245277.1.1992 WP_001245277.1.19938 WP_001245277.1.19967 WP_001245277.1.19975 WP_001245277.1.1998 WP_001245277.1.19999 WP_001245277.1.20 WP_001245277.1.20023 WP_001245277.1.20034 WP_001245277.1.20081 WP_001245277.1.20086 WP_001245277.1.2010 WP_001245277.1.20212 WP_001245277.1.20254 WP_001245277.1.20255 WP_001245277.1.2026 WP_001245277.1.20261 WP_001245277.1.20266 WP_001245277.1.20271 WP_001245277.1.20296 WP_001245277.1.20330 WP_001245277.1.20339 WP_001245277.1.2036 WP_001245277.1.20362 WP_001245277.1.20376 WP_001245277.1.20391 WP_001245277.1.2041 WP_001245277.1.20415 WP_001245277.1.20418 WP_001245277.1.20419 WP_001245277.1.20425 WP_001245277.1.20437 WP_001245277.1.20443 WP_001245277.1.20446 WP_001245277.1.20465 WP_001245277.1.2047 WP_001245277.1.20488 WP_001245277.1.20492 WP_001245277.1.20525 WP_001245277.1.2053 WP_001245277.1.2054 WP_001245277.1.20553 WP_001245277.1.20564 WP_001245277.1.20573 WP_001245277.1.20614 WP_001245277.1.20626 WP_001245277.1.20631 WP_001245277.1.20635 WP_001245277.1.20646 WP_001245277.1.20695 WP_001245277.1.20700 WP_001245277.1.20718 WP_001245277.1.20721 WP_001245277.1.2073 WP_001245277.1.20740 WP_001245277.1.20767 WP_001245277.1.20795 WP_001245277.1.20810 WP_001245277.1.20828 WP_001245277.1.20839 WP_001245277.1.20862 WP_001245277.1.2087 WP_001245277.1.20883 WP_001245277.1.20886 WP_001245277.1.20894 WP_001245277.1.20900 WP_001245277.1.20908 WP_001245277.1.2091 WP_001245277.1.20947 WP_001245277.1.20953 WP_001245277.1.2101 WP_001245277.1.21010 WP_001245277.1.21049 WP_001245277.1.2106 WP_001245277.1.21062 WP_001245277.1.2107 WP_001245277.1.21075 WP_001245277.1.21079 WP_001245277.1.21086 WP_001245277.1.21089 WP_001245277.1.21103 WP_001245277.1.21136 WP_001245277.1.21144 WP_001245277.1.21146 WP_001245277.1.2116 WP_001245277.1.21162 WP_001245277.1.21165 WP_001245277.1.21184 WP_001245277.1.21185 WP_001245277.1.21194 WP_001245277.1.21202 WP_001245277.1.21241 WP_001245277.1.21245 WP_001245277.1.21246 WP_001245277.1.21260 WP_001245277.1.21269 WP_001245277.1.21309 WP_001245277.1.21326 WP_001245277.1.21332 WP_001245277.1.21351 WP_001245277.1.21366 WP_001245277.1.2139 WP_001245277.1.21400 WP_001245277.1.21453 WP_001245277.1.2146 WP_001245277.1.21473 WP_001245277.1.21492 WP_001245277.1.21497 WP_001245277.1.21499 WP_001245277.1.21534 WP_001245277.1.21548 WP_001245277.1.21603 WP_001245277.1.21616 WP_001245277.1.2166 WP_001245277.1.21674 WP_001245277.1.21681 WP_001245277.1.21692 WP_001245277.1.21715 WP_001245277.1.21728 WP_001245277.1.21750 WP_001245277.1.21751 WP_001245277.1.21757 WP_001245277.1.21792 WP_001245277.1.21886 WP_001245277.1.21909 WP_001245277.1.21946 WP_001245277.1.21950 WP_001245277.1.21966 WP_001245277.1.21981 WP_001245277.1.21991 WP_001245277.1.22024 WP_001245277.1.22030 WP_001245277.1.2205 WP_001245277.1.22051 WP_001245277.1.22062 WP_001245277.1.22064 WP_001245277.1.22067 WP_001245277.1.22096 WP_001245277.1.22118 WP_001245277.1.22126 WP_001245277.1.22136 WP_001245277.1.22158 WP_001245277.1.2216 WP_001245277.1.22162 WP_001245277.1.22169 WP_001245277.1.22208 WP_001245277.1.2221 WP_001245277.1.22235 WP_001245277.1.2224 WP_001245277.1.22240 WP_001245277.1.2227 WP_001245277.1.22270 WP_001245277.1.22296 WP_001245277.1.22315 WP_001245277.1.22337 WP_001245277.1.22346 WP_001245277.1.2235 WP_001245277.1.22373 WP_001245277.1.22379 WP_001245277.1.22427 WP_001245277.1.22449 WP_001245277.1.22451 WP_001245277.1.22453 WP_001245277.1.22454 WP_001245277.1.2246 WP_001245277.1.22460 WP_001245277.1.22476 WP_001245277.1.22485 WP_001245277.1.22514 WP_001245277.1.22537 WP_001245277.1.22566 WP_001245277.1.22575 WP_001245277.1.22582 WP_001245277.1.22590 WP_001245277.1.22595 WP_001245277.1.22604 WP_001245277.1.22605 WP_001245277.1.22614 WP_001245277.1.22620 WP_001245277.1.22652 WP_001245277.1.22676 WP_001245277.1.22683 WP_001245277.1.22692 WP_001245277.1.22758 WP_001245277.1.22760 WP_001245277.1.2284 WP_001245277.1.22845 WP_001245277.1.22857 WP_001245277.1.22864 WP_001245277.1.22870 WP_001245277.1.22880 WP_001245277.1.22895 WP_001245277.1.22902 WP_001245277.1.22926 WP_001245277.1.22943 WP_001245277.1.22947 WP_001245277.1.22966 WP_001245277.1.22967 WP_001245277.1.22979 WP_001245277.1.23010 WP_001245277.1.23040 WP_001245277.1.23058 WP_001245277.1.23080 WP_001245277.1.23102 WP_001245277.1.23114 WP_001245277.1.2314 WP_001245277.1.23155 WP_001245277.1.23169 WP_001245277.1.23172 WP_001245277.1.23192 WP_001245277.1.23218 WP_001245277.1.2324 WP_001245277.1.23246 WP_001245277.1.23258 WP_001245277.1.23259 WP_001245277.1.23274 WP_001245277.1.2331 WP_001245277.1.2332 WP_001245277.1.23329 WP_001245277.1.23340 WP_001245277.1.2336 WP_001245277.1.23365 WP_001245277.1.23379 WP_001245277.1.23412 WP_001245277.1.2342 WP_001245277.1.23426 WP_001245277.1.23442 WP_001245277.1.23460 WP_001245277.1.23466 WP_001245277.1.23472 WP_001245277.1.23482 WP_001245277.1.23485 WP_001245277.1.23492 WP_001245277.1.23509 WP_001245277.1.23515 WP_001245277.1.23529 WP_001245277.1.23548 WP_001245277.1.23571 WP_001245277.1.2358 WP_001245277.1.23587 WP_001245277.1.23604 WP_001245277.1.23621 WP_001245277.1.23629 WP_001245277.1.23631 WP_001245277.1.23634 WP_001245277.1.2364 WP_001245277.1.23643 WP_001245277.1.23646 WP_001245277.1.23675 WP_001245277.1.23679 WP_001245277.1.23685 WP_001245277.1.23707 WP_001245277.1.23728 WP_001245277.1.23736 WP_001245277.1.23746 WP_001245277.1.2375 WP_001245277.1.23755 WP_001245277.1.2376 WP_001245277.1.23783 WP_001245277.1.23786 WP_001245277.1.23787 WP_001245277.1.23801 WP_001245277.1.23819 WP_001245277.1.23932 WP_001245277.1.23959 WP_001245277.1.24017 WP_001245277.1.24028 WP_001245277.1.24061 WP_001245277.1.24082 WP_001245277.1.24083 WP_001245277.1.24117 WP_001245277.1.24125 WP_001245277.1.24138 WP_001245277.1.24145 WP_001245277.1.2415 WP_001245277.1.24153 WP_001245277.1.24158 WP_001245277.1.24163 WP_001245277.1.24206 WP_001245277.1.24214 WP_001245277.1.24250 WP_001245277.1.24259 WP_001245277.1.24291 WP_001245277.1.24297 WP_001245277.1.24308 WP_001245277.1.24322 WP_001245277.1.24325 WP_001245277.1.24355 WP_001245277.1.24361 WP_001245277.1.24375 WP_001245277.1.24376 WP_001245277.1.24392 WP_001245277.1.24394 WP_001245277.1.24400 WP_001245277.1.24408 WP_001245277.1.24409 WP_001245277.1.24412 WP_001245277.1.24419 WP_001245277.1.24420 WP_001245277.1.24433 WP_001245277.1.24494 WP_001245277.1.24521 WP_001245277.1.24555 WP_001245277.1.24578 WP_001245277.1.24619 WP_001245277.1.24643 WP_001245277.1.2467 WP_001245277.1.24673 WP_001245277.1.24688 WP_001245277.1.24689 WP_001245277.1.24696 WP_001245277.1.24716 WP_001245277.1.24723 WP_001245277.1.24737 WP_001245277.1.24779 WP_001245277.1.24803 WP_001245277.1.2481 WP_001245277.1.24832 WP_001245277.1.24837 WP_001245277.1.24873 WP_001245277.1.24901 WP_001245277.1.24944 WP_001245277.1.24964 WP_001245277.1.24995 WP_001245277.1.25008 WP_001245277.1.25015 WP_001245277.1.25017 WP_001245277.1.25032 WP_001245277.1.25041 WP_001245277.1.25053 WP_001245277.1.25130 WP_001245277.1.25140 WP_001245277.1.25159 WP_001245277.1.25175 WP_001245277.1.25185 WP_001245277.1.25196 WP_001245277.1.25205 WP_001245277.1.25206 WP_001245277.1.25210 WP_001245277.1.25219 WP_001245277.1.25229 WP_001245277.1.25304 WP_001245277.1.25354 WP_001245277.1.25374 WP_001245277.1.25397 WP_001245277.1.25405 WP_001245277.1.25421 WP_001245277.1.25426 WP_001245277.1.25454 WP_001245277.1.25475 WP_001245277.1.25490 WP_001245277.1.25493 WP_001245277.1.25498 WP_001245277.1.25508 WP_001245277.1.25512 WP_001245277.1.25514 WP_001245277.1.2554 WP_001245277.1.25546 WP_001245277.1.25603 WP_001245277.1.25607 WP_001245277.1.25618 WP_001245277.1.2562 WP_001245277.1.25666 WP_001245277.1.25668 WP_001245277.1.2568 WP_001245277.1.25690 WP_001245277.1.25692 WP_001245277.1.2570 WP_001245277.1.25700 WP_001245277.1.25703 WP_001245277.1.25708 WP_001245277.1.25709 WP_001245277.1.25722 WP_001245277.1.25740 WP_001245277.1.25780 WP_001245277.1.25793 WP_001245277.1.25807 WP_001245277.1.25809 WP_001245277.1.25814 WP_001245277.1.25821 WP_001245277.1.25825 WP_001245277.1.25833 WP_001245277.1.25835 WP_001245277.1.25882 WP_001245277.1.25911 WP_001245277.1.25928 WP_001245277.1.25932 WP_001245277.1.25951 WP_001245277.1.25962 WP_001245277.1.25963 WP_001245277.1.25988 WP_001245277.1.26001 WP_001245277.1.26027 WP_001245277.1.26030 WP_001245277.1.26083 WP_001245277.1.26093 WP_001245277.1.26107 WP_001245277.1.26122 WP_001245277.1.26129 WP_001245277.1.2615 WP_001245277.1.26194 WP_001245277.1.26199 WP_001245277.1.26217 WP_001245277.1.26224 WP_001245277.1.26230 WP_001245277.1.26232 WP_001245277.1.26269 WP_001245277.1.26272 WP_001245277.1.26282 WP_001245277.1.26286 WP_001245277.1.26288 WP_001245277.1.26311 WP_001245277.1.26319 WP_001245277.1.2634 WP_001245277.1.26363 WP_001245277.1.26384 WP_001245277.1.26394 WP_001245277.1.26426 WP_001245277.1.26429 WP_001245277.1.26440 WP_001245277.1.26441 WP_001245277.1.26491 WP_001245277.1.26493 WP_001245277.1.26532 WP_001245277.1.2654 WP_001245277.1.26551 WP_001245277.1.26554 WP_001245277.1.26567 WP_001245277.1.26576 WP_001245277.1.26582 WP_001245277.1.26587 WP_001245277.1.2660 WP_001245277.1.26636 WP_001245277.1.26646 WP_001245277.1.26687 WP_001245277.1.26689 WP_001245277.1.26709 WP_001245277.1.2672 WP_001245277.1.26741 WP_001245277.1.26750 WP_001245277.1.26787 WP_001245277.1.2679 WP_001245277.1.26794 WP_001245277.1.26833 WP_001245277.1.26882 WP_001245277.1.26883 WP_001245277.1.26908 WP_001245277.1.26919 WP_001245277.1.2692 WP_001245277.1.26924 WP_001245277.1.26928 WP_001245277.1.26936 WP_001245277.1.270 WP_001245277.1.27008 WP_001245277.1.27010 WP_001245277.1.27027 WP_001245277.1.27070 WP_001245277.1.27072 WP_001245277.1.27077 WP_001245277.1.27084 WP_001245277.1.27086 WP_001245277.1.27087 WP_001245277.1.27111 WP_001245277.1.27115 WP_001245277.1.2713 WP_001245277.1.27142 WP_001245277.1.2717 WP_001245277.1.27173 WP_001245277.1.272 WP_001245277.1.27206 WP_001245277.1.27223 WP_001245277.1.27228 WP_001245277.1.2723 WP_001245277.1.27272 WP_001245277.1.27279 WP_001245277.1.27282 WP_001245277.1.27285 WP_001245277.1.27309 WP_001245277.1.27314 WP_001245277.1.27329 WP_001245277.1.27342 WP_001245277.1.27361 WP_001245277.1.27383 WP_001245277.1.27419 WP_001245277.1.27423 WP_001245277.1.27452 WP_001245277.1.27513 WP_001245277.1.27522 WP_001245277.1.27544 WP_001245277.1.27547 WP_001245277.1.27556 WP_001245277.1.27565 WP_001245277.1.27595 WP_001245277.1.27598 WP_001245277.1.27616 WP_001245277.1.2763 WP_001245277.1.27632 WP_001245277.1.27638 WP_001245277.1.27655 WP_001245277.1.27658 WP_001245277.1.27665 WP_001245277.1.27679 WP_001245277.1.27706 WP_001245277.1.27707 WP_001245277.1.27713 WP_001245277.1.27761 WP_001245277.1.2777 WP_001245277.1.27775 WP_001245277.1.27776 WP_001245277.1.27785 WP_001245277.1.27800 WP_001245277.1.27815 WP_001245277.1.27833 WP_001245277.1.27857 WP_001245277.1.27883 WP_001245277.1.27900 WP_001245277.1.27928 WP_001245277.1.27945 WP_001245277.1.27969 WP_001245277.1.27977 WP_001245277.1.27995 WP_001245277.1.27997 WP_001245277.1.28004 WP_001245277.1.28032 WP_001245277.1.28037 WP_001245277.1.28056 WP_001245277.1.2806 WP_001245277.1.2809 WP_001245277.1.28094 WP_001245277.1.28126 WP_001245277.1.28139 WP_001245277.1.28155 WP_001245277.1.28170 WP_001245277.1.28174 WP_001245277.1.28198 WP_001245277.1.28200 WP_001245277.1.2822 WP_001245277.1.28225 WP_001245277.1.28229 WP_001245277.1.28232 WP_001245277.1.28233 WP_001245277.1.2825 WP_001245277.1.28267 WP_001245277.1.2829 WP_001245277.1.28302 WP_001245277.1.28303 WP_001245277.1.2835 WP_001245277.1.28370 WP_001245277.1.28384 WP_001245277.1.28386 WP_001245277.1.28393 WP_001245277.1.28395 WP_001245277.1.284 WP_001245277.1.2845 WP_001245277.1.28462 WP_001245277.1.28479 WP_001245277.1.28504 WP_001245277.1.28514 WP_001245277.1.2853 WP_001245277.1.28538 WP_001245277.1.28570 WP_001245277.1.28575 WP_001245277.1.28612 WP_001245277.1.28620 WP_001245277.1.28625 WP_001245277.1.28627 WP_001245277.1.28655 WP_001245277.1.28692 WP_001245277.1.28694 WP_001245277.1.287 WP_001245277.1.2873 WP_001245277.1.28733 WP_001245277.1.28773 WP_001245277.1.28775 WP_001245277.1.28776 WP_001245277.1.2879 WP_001245277.1.28811 WP_001245277.1.28830 WP_001245277.1.2890 WP_001245277.1.28902 WP_001245277.1.28917 WP_001245277.1.28921 WP_001245277.1.28938 WP_001245277.1.28946 WP_001245277.1.28948 WP_001245277.1.28962 WP_001245277.1.28963 WP_001245277.1.28977 WP_001245277.1.29006 WP_001245277.1.29010 WP_001245277.1.29023 WP_001245277.1.29042 WP_001245277.1.2905 WP_001245277.1.2907 WP_001245277.1.29081 WP_001245277.1.29089 WP_001245277.1.29099 WP_001245277.1.2910 WP_001245277.1.29113 WP_001245277.1.29153 WP_001245277.1.29168 WP_001245277.1.29174 WP_001245277.1.29190 WP_001245277.1.29203 WP_001245277.1.29218 WP_001245277.1.29237 WP_001245277.1.2924 WP_001245277.1.29248 WP_001245277.1.29255 WP_001245277.1.29265 WP_001245277.1.29274 WP_001245277.1.29288 WP_001245277.1.2932 WP_001245277.1.29349 WP_001245277.1.29379 WP_001245277.1.29389 WP_001245277.1.29422 WP_001245277.1.29436 WP_001245277.1.29439 WP_001245277.1.2946 WP_001245277.1.29462 WP_001245277.1.29509 WP_001245277.1.29530 WP_001245277.1.29563 WP_001245277.1.29576 WP_001245277.1.29588 WP_001245277.1.29593 WP_001245277.1.29601 WP_001245277.1.29606 WP_001245277.1.29615 WP_001245277.1.29619 WP_001245277.1.29682 WP_001245277.1.29704 WP_001245277.1.29711 WP_001245277.1.29727 WP_001245277.1.29732 WP_001245277.1.29743 WP_001245277.1.29768 WP_001245277.1.29775 WP_001245277.1.29782 WP_001245277.1.29827 WP_001245277.1.29833 WP_001245277.1.2984 WP_001245277.1.29845 WP_001245277.1.29851 WP_001245277.1.29865 WP_001245277.1.29886 WP_001245277.1.29898 WP_001245277.1.29919 WP_001245277.1.29923 WP_001245277.1.29924 WP_001245277.1.2994 WP_001245277.1.29964 WP_001245277.1.29969 WP_001245277.1.29983 WP_001245277.1.29990 WP_001245277.1.30006 WP_001245277.1.30009 WP_001245277.1.30013 WP_001245277.1.30018 WP_001245277.1.3002 WP_001245277.1.30022 WP_001245277.1.30027 WP_001245277.1.30034 WP_001245277.1.30049 WP_001245277.1.3005 WP_001245277.1.30058 WP_001245277.1.30059 WP_001245277.1.30086 WP_001245277.1.30093 WP_001245277.1.30165 WP_001245277.1.3017 WP_001245277.1.30172 WP_001245277.1.30180 WP_001245277.1.30185 WP_001245277.1.30195 WP_001245277.1.30202 WP_001245277.1.30210 WP_001245277.1.30213 WP_001245277.1.30225 WP_001245277.1.30238 WP_001245277.1.30278 WP_001245277.1.30331 WP_001245277.1.30354 WP_001245277.1.30356 WP_001245277.1.30357 WP_001245277.1.30362 WP_001245277.1.30386 WP_001245277.1.3042 WP_001245277.1.30421 WP_001245277.1.30440 WP_001245277.1.30448 WP_001245277.1.30469 WP_001245277.1.30489 WP_001245277.1.30492 WP_001245277.1.30505 WP_001245277.1.30507 WP_001245277.1.30517 WP_001245277.1.30535 WP_001245277.1.30542 WP_001245277.1.30547 WP_001245277.1.30548 WP_001245277.1.30555 WP_001245277.1.30556 WP_001245277.1.30572 WP_001245277.1.30573 WP_001245277.1.30585 WP_001245277.1.30589 WP_001245277.1.30602 WP_001245277.1.30618 WP_001245277.1.30619 WP_001245277.1.30627 WP_001245277.1.3066 WP_001245277.1.30664 WP_001245277.1.3067 WP_001245277.1.3068 WP_001245277.1.30688 WP_001245277.1.30696 WP_001245277.1.30752 WP_001245277.1.3076 WP_001245277.1.30794 WP_001245277.1.30802 WP_001245277.1.30803 WP_001245277.1.30806 WP_001245277.1.30833 WP_001245277.1.30835 WP_001245277.1.3089 WP_001245277.1.30909 WP_001245277.1.30967 WP_001245277.1.30968 WP_001245277.1.30972 WP_001245277.1.31 WP_001245277.1.31046 WP_001245277.1.31066 WP_001245277.1.31069 WP_001245277.1.31078 WP_001245277.1.31086 WP_001245277.1.31092 WP_001245277.1.31107 WP_001245277.1.31111 WP_001245277.1.31122 WP_001245277.1.3113 WP_001245277.1.31139 WP_001245277.1.3114 WP_001245277.1.31145 WP_001245277.1.31155 WP_001245277.1.31156 WP_001245277.1.31167 WP_001245277.1.31171 WP_001245277.1.31182 WP_001245277.1.31185 WP_001245277.1.3119 WP_001245277.1.31190 WP_001245277.1.31195 WP_001245277.1.31196 WP_001245277.1.31205 WP_001245277.1.3121 WP_001245277.1.31210 WP_001245277.1.31214 WP_001245277.1.31219 WP_001245277.1.31223 WP_001245277.1.3124 WP_001245277.1.3127 WP_001245277.1.31272 WP_001245277.1.31281 WP_001245277.1.31303 WP_001245277.1.3131 WP_001245277.1.31335 WP_001245277.1.31352 WP_001245277.1.31362 WP_001245277.1.31389 WP_001245277.1.31413 WP_001245277.1.31435 WP_001245277.1.31446 WP_001245277.1.31451 WP_001245277.1.31476 WP_001245277.1.31504 WP_001245277.1.31515 WP_001245277.1.31533 WP_001245277.1.31546 WP_001245277.1.31578 WP_001245277.1.31585 WP_001245277.1.31658 WP_001245277.1.31665 WP_001245277.1.3167 WP_001245277.1.3170 WP_001245277.1.31720 WP_001245277.1.31762 WP_001245277.1.31782 WP_001245277.1.31799 WP_001245277.1.31836 WP_001245277.1.31845 WP_001245277.1.3185 WP_001245277.1.31854 WP_001245277.1.31895 WP_001245277.1.31901 WP_001245277.1.31927 WP_001245277.1.31940 WP_001245277.1.31951 WP_001245277.1.31952 WP_001245277.1.31967 WP_001245277.1.31972 WP_001245277.1.31983 WP_001245277.1.32041 WP_001245277.1.32042 WP_001245277.1.3207 WP_001245277.1.32109 WP_001245277.1.32116 WP_001245277.1.32189 WP_001245277.1.32192 WP_001245277.1.32202 WP_001245277.1.32206 WP_001245277.1.32252 WP_001245277.1.32255 WP_001245277.1.32260 WP_001245277.1.32263 WP_001245277.1.32274 WP_001245277.1.32277 WP_001245277.1.32293 WP_001245277.1.32299 WP_001245277.1.32309 WP_001245277.1.32357 WP_001245277.1.32408 WP_001245277.1.32422 WP_001245277.1.32424 WP_001245277.1.32425 WP_001245277.1.32434 WP_001245277.1.32438 WP_001245277.1.32458 WP_001245277.1.32460 WP_001245277.1.32491 WP_001245277.1.32493 WP_001245277.1.32515 WP_001245277.1.32519 WP_001245277.1.32527 WP_001245277.1.32529 WP_001245277.1.32563 WP_001245277.1.32578 WP_001245277.1.32617 WP_001245277.1.32629 WP_001245277.1.32643 WP_001245277.1.32660 WP_001245277.1.32668 WP_001245277.1.3270 WP_001245277.1.32702 WP_001245277.1.32714 WP_001245277.1.32725 WP_001245277.1.32740 WP_001245277.1.32747 WP_001245277.1.32750 WP_001245277.1.3278 WP_001245277.1.32786 WP_001245277.1.32804 WP_001245277.1.32832 WP_001245277.1.32838 WP_001245277.1.32848 WP_001245277.1.32860 WP_001245277.1.32868 WP_001245277.1.32881 WP_001245277.1.32899 WP_001245277.1.3290 WP_001245277.1.32900 WP_001245277.1.32902 WP_001245277.1.32907 WP_001245277.1.32940 WP_001245277.1.32941 WP_001245277.1.3296 WP_001245277.1.32966 WP_001245277.1.32977 WP_001245277.1.32985 WP_001245277.1.33010 WP_001245277.1.33030 WP_001245277.1.33037 WP_001245277.1.3305 WP_001245277.1.33051 WP_001245277.1.33065 WP_001245277.1.33078 WP_001245277.1.33106 WP_001245277.1.33122 WP_001245277.1.33127 WP_001245277.1.33143 WP_001245277.1.3315 WP_001245277.1.33208 WP_001245277.1.33214 WP_001245277.1.33247 WP_001245277.1.33248 WP_001245277.1.33253 WP_001245277.1.33261 WP_001245277.1.33270 WP_001245277.1.33280 WP_001245277.1.33283 WP_001245277.1.333 WP_001245277.1.33313 WP_001245277.1.33339 WP_001245277.1.33343 WP_001245277.1.33382 WP_001245277.1.33392 WP_001245277.1.33409 WP_001245277.1.33420 WP_001245277.1.33490 WP_001245277.1.33492 WP_001245277.1.33499 WP_001245277.1.335 WP_001245277.1.33501 WP_001245277.1.33504 WP_001245277.1.33529 WP_001245277.1.33553 WP_001245277.1.3356 WP_001245277.1.33580 WP_001245277.1.33586 WP_001245277.1.33592 WP_001245277.1.33609 WP_001245277.1.3364 WP_001245277.1.33659 WP_001245277.1.33689 WP_001245277.1.3370 WP_001245277.1.33730 WP_001245277.1.33741 WP_001245277.1.33786 WP_001245277.1.33817 WP_001245277.1.33825 WP_001245277.1.33840 WP_001245277.1.33865 WP_001245277.1.33870 WP_001245277.1.33894 WP_001245277.1.3392 WP_001245277.1.33926 WP_001245277.1.3394 WP_001245277.1.3395 WP_001245277.1.33957 WP_001245277.1.3396 WP_001245277.1.33969 WP_001245277.1.33986 WP_001245277.1.34001 WP_001245277.1.34022 WP_001245277.1.34043 WP_001245277.1.34059 WP_001245277.1.34075 WP_001245277.1.34084 WP_001245277.1.34091 WP_001245277.1.34107 WP_001245277.1.34118 WP_001245277.1.34179 WP_001245277.1.34185 WP_001245277.1.34211 WP_001245277.1.34214 WP_001245277.1.34234 WP_001245277.1.34257 WP_001245277.1.34259 WP_001245277.1.34279 WP_001245277.1.34284 WP_001245277.1.34292 WP_001245277.1.34319 WP_001245277.1.34330 WP_001245277.1.34376 WP_001245277.1.3438 WP_001245277.1.34382 WP_001245277.1.34417 WP_001245277.1.34424 WP_001245277.1.34431 WP_001245277.1.34453 WP_001245277.1.34454 WP_001245277.1.34458 WP_001245277.1.34484 WP_001245277.1.34496 WP_001245277.1.34517 WP_001245277.1.34530 WP_001245277.1.34610 WP_001245277.1.34614 WP_001245277.1.34659 WP_001245277.1.34665 WP_001245277.1.34667 WP_001245277.1.34684 WP_001245277.1.34694 WP_001245277.1.34704 WP_001245277.1.34711 WP_001245277.1.34751 WP_001245277.1.34808 WP_001245277.1.34817 WP_001245277.1.34820 WP_001245277.1.34824 WP_001245277.1.34834 WP_001245277.1.34854 WP_001245277.1.34856 WP_001245277.1.34881 WP_001245277.1.3489 WP_001245277.1.34932 WP_001245277.1.34962 WP_001245277.1.34972 WP_001245277.1.34975 WP_001245277.1.34977 WP_001245277.1.35001 WP_001245277.1.35040 WP_001245277.1.35045 WP_001245277.1.35074 WP_001245277.1.35129 WP_001245277.1.35175 WP_001245277.1.35184 WP_001245277.1.35193 WP_001245277.1.35219 WP_001245277.1.35240 WP_001245277.1.35274 WP_001245277.1.35298 WP_001245277.1.35321 WP_001245277.1.35331 WP_001245277.1.35332 WP_001245277.1.35404 WP_001245277.1.35408 WP_001245277.1.3541 WP_001245277.1.35425 WP_001245277.1.35429 WP_001245277.1.35446 WP_001245277.1.35460 WP_001245277.1.35463 WP_001245277.1.35494 WP_001245277.1.35503 WP_001245277.1.35507 WP_001245277.1.35509 WP_001245277.1.35532 WP_001245277.1.3556 WP_001245277.1.35560 WP_001245277.1.35563 WP_001245277.1.3557 WP_001245277.1.35570 WP_001245277.1.35590 WP_001245277.1.35594 WP_001245277.1.35619 WP_001245277.1.35624 WP_001245277.1.35628 WP_001245277.1.3570 WP_001245277.1.35712 WP_001245277.1.35713 WP_001245277.1.3572 WP_001245277.1.35736 WP_001245277.1.35791 WP_001245277.1.35795 WP_001245277.1.35809 WP_001245277.1.35835 WP_001245277.1.35868 WP_001245277.1.35870 WP_001245277.1.35887 WP_001245277.1.35892 WP_001245277.1.35916 WP_001245277.1.35936 WP_001245277.1.35938 WP_001245277.1.35940 WP_001245277.1.35961 WP_001245277.1.35966 WP_001245277.1.35993 WP_001245277.1.36000 WP_001245277.1.36003 WP_001245277.1.3601 WP_001245277.1.36017 WP_001245277.1.36034 WP_001245277.1.36036 WP_001245277.1.36037 WP_001245277.1.36057 WP_001245277.1.36063 WP_001245277.1.36069 WP_001245277.1.36157 WP_001245277.1.36172 WP_001245277.1.36229 WP_001245277.1.36232 WP_001245277.1.36236 WP_001245277.1.36291 WP_001245277.1.36298 WP_001245277.1.36308 WP_001245277.1.36323 WP_001245277.1.36343 WP_001245277.1.36409 WP_001245277.1.36425 WP_001245277.1.36445 WP_001245277.1.36460 WP_001245277.1.3649 WP_001245277.1.36495 WP_001245277.1.36512 WP_001245277.1.36526 WP_001245277.1.36547 WP_001245277.1.36567 WP_001245277.1.36579 WP_001245277.1.36584 WP_001245277.1.36586 WP_001245277.1.36592 WP_001245277.1.36609 WP_001245277.1.36617 WP_001245277.1.36618 WP_001245277.1.36643 WP_001245277.1.36663 WP_001245277.1.36685 WP_001245277.1.36690 WP_001245277.1.3670 WP_001245277.1.36701 WP_001245277.1.36705 WP_001245277.1.36721 WP_001245277.1.36725 WP_001245277.1.36751 WP_001245277.1.36764 WP_001245277.1.36779 WP_001245277.1.36798 WP_001245277.1.36802 WP_001245277.1.36821 WP_001245277.1.36853 WP_001245277.1.36885 WP_001245277.1.36889 WP_001245277.1.36899 WP_001245277.1.36918 WP_001245277.1.36931 WP_001245277.1.36948 WP_001245277.1.36950 WP_001245277.1.36978 WP_001245277.1.37014 WP_001245277.1.37021 WP_001245277.1.37028 WP_001245277.1.37029 WP_001245277.1.37063 WP_001245277.1.37073 WP_001245277.1.37100 WP_001245277.1.37111 WP_001245277.1.37112 WP_001245277.1.37114 WP_001245277.1.37119 WP_001245277.1.37133 WP_001245277.1.37147 WP_001245277.1.37158 WP_001245277.1.37176 WP_001245277.1.37191 WP_001245277.1.37199 WP_001245277.1.37200 WP_001245277.1.37256 WP_001245277.1.37258 WP_001245277.1.3726 WP_001245277.1.3728 WP_001245277.1.37293 WP_001245277.1.37297 WP_001245277.1.37303 WP_001245277.1.3734 WP_001245277.1.37351 WP_001245277.1.37370 WP_001245277.1.37376 WP_001245277.1.37405 WP_001245277.1.3744 WP_001245277.1.37478 WP_001245277.1.3748 WP_001245277.1.37498 WP_001245277.1.37504 WP_001245277.1.37513 WP_001245277.1.37521 WP_001245277.1.37558 WP_001245277.1.3756 WP_001245277.1.37584 WP_001245277.1.37590 WP_001245277.1.37593 WP_001245277.1.37600 WP_001245277.1.37610 WP_001245277.1.37613 WP_001245277.1.37618 WP_001245277.1.37659 WP_001245277.1.37662 WP_001245277.1.37666 WP_001245277.1.37675 WP_001245277.1.37687 WP_001245277.1.37691 WP_001245277.1.3771 WP_001245277.1.37761 WP_001245277.1.37775 WP_001245277.1.3778 WP_001245277.1.378 WP_001245277.1.37808 WP_001245277.1.37848 WP_001245277.1.37864 WP_001245277.1.379 WP_001245277.1.3790 WP_001245277.1.37911 WP_001245277.1.37941 WP_001245277.1.37965 WP_001245277.1.37968 WP_001245277.1.37978 WP_001245277.1.37985 WP_001245277.1.38001 WP_001245277.1.38026 WP_001245277.1.38037 WP_001245277.1.38047 WP_001245277.1.38055 WP_001245277.1.38061 WP_001245277.1.38064 WP_001245277.1.38108 WP_001245277.1.38113 WP_001245277.1.38125 WP_001245277.1.38145 WP_001245277.1.3816 WP_001245277.1.38199 WP_001245277.1.38207 WP_001245277.1.38261 WP_001245277.1.38266 WP_001245277.1.38273 WP_001245277.1.3828 WP_001245277.1.383 WP_001245277.1.38310 WP_001245277.1.3834 WP_001245277.1.38341 WP_001245277.1.38344 WP_001245277.1.38351 WP_001245277.1.3838 WP_001245277.1.38381 WP_001245277.1.38393 WP_001245277.1.38408 WP_001245277.1.38440 WP_001245277.1.38452 WP_001245277.1.3848 WP_001245277.1.38486 WP_001245277.1.38515 WP_001245277.1.38569 WP_001245277.1.38595 WP_001245277.1.3860 WP_001245277.1.38609 WP_001245277.1.38613 WP_001245277.1.38620 WP_001245277.1.38642 WP_001245277.1.38673 WP_001245277.1.3869 WP_001245277.1.38693 WP_001245277.1.38734 WP_001245277.1.38773 WP_001245277.1.38781 WP_001245277.1.38877 WP_001245277.1.38881 WP_001245277.1.38882 WP_001245277.1.38895 WP_001245277.1.38898 WP_001245277.1.3891 WP_001245277.1.38913 WP_001245277.1.38942 WP_001245277.1.38983 WP_001245277.1.38995 WP_001245277.1.38996 WP_001245277.1.39003 WP_001245277.1.39038 WP_001245277.1.39048 WP_001245277.1.39055 WP_001245277.1.39056 WP_001245277.1.39059 WP_001245277.1.39065 WP_001245277.1.3907 WP_001245277.1.39082 WP_001245277.1.39105 WP_001245277.1.39136 WP_001245277.1.3914 WP_001245277.1.39140 WP_001245277.1.39147 WP_001245277.1.39161 WP_001245277.1.39197 WP_001245277.1.39210 WP_001245277.1.39229 WP_001245277.1.39235 WP_001245277.1.39265 WP_001245277.1.3931 WP_001245277.1.39311 WP_001245277.1.39312 WP_001245277.1.39385 WP_001245277.1.39395 WP_001245277.1.39405 WP_001245277.1.39414 WP_001245277.1.39420 WP_001245277.1.39435 WP_001245277.1.39449 WP_001245277.1.39466 WP_001245277.1.39502 WP_001245277.1.39503 WP_001245277.1.39512 WP_001245277.1.39530 WP_001245277.1.39553 WP_001245277.1.39556 WP_001245277.1.39576 WP_001245277.1.39584 WP_001245277.1.39609 WP_001245277.1.39614 WP_001245277.1.39619 WP_001245277.1.39620 WP_001245277.1.39624 WP_001245277.1.39629 WP_001245277.1.39632 WP_001245277.1.39659 WP_001245277.1.39667 WP_001245277.1.39722 WP_001245277.1.39724 WP_001245277.1.39763 WP_001245277.1.39775 WP_001245277.1.39862 WP_001245277.1.39879 WP_001245277.1.39890 WP_001245277.1.39921 WP_001245277.1.39923 WP_001245277.1.39941 WP_001245277.1.39945 WP_001245277.1.39947 WP_001245277.1.39953 WP_001245277.1.40017 WP_001245277.1.40031 WP_001245277.1.40072 WP_001245277.1.40073 WP_001245277.1.40081 WP_001245277.1.40095 WP_001245277.1.40097 WP_001245277.1.401 WP_001245277.1.4011 WP_001245277.1.40111 WP_001245277.1.40155 WP_001245277.1.40158 WP_001245277.1.40160 WP_001245277.1.40167 WP_001245277.1.40170 WP_001245277.1.40171 WP_001245277.1.40208 WP_001245277.1.40224 WP_001245277.1.40229 WP_001245277.1.40240 WP_001245277.1.40254 WP_001245277.1.40257 WP_001245277.1.40258 WP_001245277.1.40259 WP_001245277.1.40279 WP_001245277.1.40284 WP_001245277.1.40292 WP_001245277.1.40305 WP_001245277.1.40307 WP_001245277.1.40311 WP_001245277.1.40341 WP_001245277.1.40361 WP_001245277.1.40374 WP_001245277.1.40380 WP_001245277.1.40395 WP_001245277.1.4042 WP_001245277.1.40465 WP_001245277.1.40467 WP_001245277.1.40492 WP_001245277.1.40493 WP_001245277.1.40496 WP_001245277.1.40508 WP_001245277.1.40517 WP_001245277.1.40528 WP_001245277.1.40533 WP_001245277.1.40577 WP_001245277.1.40622 WP_001245277.1.40648 WP_001245277.1.40688 WP_001245277.1.40693 WP_001245277.1.40695 WP_001245277.1.40698 WP_001245277.1.40710 WP_001245277.1.40745 WP_001245277.1.4075 WP_001245277.1.40750 WP_001245277.1.40763 WP_001245277.1.40771 WP_001245277.1.40788 WP_001245277.1.40849 WP_001245277.1.40854 WP_001245277.1.4087 WP_001245277.1.40877 WP_001245277.1.4089 WP_001245277.1.40910 WP_001245277.1.40924 WP_001245277.1.40930 WP_001245277.1.40932 WP_001245277.1.40935 WP_001245277.1.40946 WP_001245277.1.40973 WP_001245277.1.40996 WP_001245277.1.41004 WP_001245277.1.41017 WP_001245277.1.41018 WP_001245277.1.41048 WP_001245277.1.41050 WP_001245277.1.4106 WP_001245277.1.41070 WP_001245277.1.41074 WP_001245277.1.41075 WP_001245277.1.41086 WP_001245277.1.4109 WP_001245277.1.41091 WP_001245277.1.41097 WP_001245277.1.41116 WP_001245277.1.41128 WP_001245277.1.41132 WP_001245277.1.41176 WP_001245277.1.41192 WP_001245277.1.41225 WP_001245277.1.41226 WP_001245277.1.41251 WP_001245277.1.41258 WP_001245277.1.41265 WP_001245277.1.41277 WP_001245277.1.41279 WP_001245277.1.41305 WP_001245277.1.41308 WP_001245277.1.41321 WP_001245277.1.41333 WP_001245277.1.41335 WP_001245277.1.41345 WP_001245277.1.4136 WP_001245277.1.41375 WP_001245277.1.4141 WP_001245277.1.41415 WP_001245277.1.41427 WP_001245277.1.41434 WP_001245277.1.41459 WP_001245277.1.41498 WP_001245277.1.41516 WP_001245277.1.41519 WP_001245277.1.41524 WP_001245277.1.41528 WP_001245277.1.41554 WP_001245277.1.41572 WP_001245277.1.41591 WP_001245277.1.41593 WP_001245277.1.41610 WP_001245277.1.41628 WP_001245277.1.41631 WP_001245277.1.41658 WP_001245277.1.41659 WP_001245277.1.41662 WP_001245277.1.41688 WP_001245277.1.41690 WP_001245277.1.41708 WP_001245277.1.41716 WP_001245277.1.41724 WP_001245277.1.41735 WP_001245277.1.41746 WP_001245277.1.41761 WP_001245277.1.4178 WP_001245277.1.41799 WP_001245277.1.41802 WP_001245277.1.41824 WP_001245277.1.41825 WP_001245277.1.41836 WP_001245277.1.4184 WP_001245277.1.41859 WP_001245277.1.41862 WP_001245277.1.41877 WP_001245277.1.41882 WP_001245277.1.41894 WP_001245277.1.41911 WP_001245277.1.41919 WP_001245277.1.41929 WP_001245277.1.41931 WP_001245277.1.41938 WP_001245277.1.41949 WP_001245277.1.41978 WP_001245277.1.41979 WP_001245277.1.41985 WP_001245277.1.42069 WP_001245277.1.42081 WP_001245277.1.42090 WP_001245277.1.42098 WP_001245277.1.42104 WP_001245277.1.42111 WP_001245277.1.42136 WP_001245277.1.42156 WP_001245277.1.42187 WP_001245277.1.422 WP_001245277.1.42200 WP_001245277.1.42219 WP_001245277.1.4222 WP_001245277.1.42243 WP_001245277.1.42248 WP_001245277.1.42257 WP_001245277.1.42261 WP_001245277.1.42262 WP_001245277.1.42263 WP_001245277.1.42276 WP_001245277.1.4229 WP_001245277.1.42320 WP_001245277.1.42322 WP_001245277.1.42328 WP_001245277.1.42342 WP_001245277.1.42349 WP_001245277.1.42356 WP_001245277.1.42364 WP_001245277.1.42371 WP_001245277.1.42372 WP_001245277.1.42379 WP_001245277.1.4239 WP_001245277.1.42391 WP_001245277.1.42392 WP_001245277.1.42394 WP_001245277.1.42399 WP_001245277.1.42422 WP_001245277.1.42444 WP_001245277.1.42453 WP_001245277.1.42489 WP_001245277.1.42491 WP_001245277.1.42539 WP_001245277.1.4257 WP_001245277.1.42595 WP_001245277.1.42603 WP_001245277.1.42605 WP_001245277.1.42650 WP_001245277.1.42666 WP_001245277.1.4267 WP_001245277.1.42675 WP_001245277.1.42676 WP_001245277.1.42683 WP_001245277.1.42685 WP_001245277.1.42701 WP_001245277.1.42734 WP_001245277.1.4276 WP_001245277.1.42797 WP_001245277.1.42805 WP_001245277.1.42815 WP_001245277.1.42829 WP_001245277.1.42859 WP_001245277.1.42861 WP_001245277.1.42864 WP_001245277.1.4288 WP_001245277.1.42887 WP_001245277.1.42892 WP_001245277.1.42923 WP_001245277.1.42932 WP_001245277.1.42957 WP_001245277.1.4298 WP_001245277.1.43008 WP_001245277.1.43016 WP_001245277.1.43018 WP_001245277.1.43019 WP_001245277.1.43041 WP_001245277.1.43065 WP_001245277.1.43068 WP_001245277.1.43069 WP_001245277.1.43070 WP_001245277.1.43077 WP_001245277.1.43086 WP_001245277.1.43128 WP_001245277.1.43141 WP_001245277.1.43157 WP_001245277.1.43160 WP_001245277.1.43161 WP_001245277.1.43190 WP_001245277.1.43198 WP_001245277.1.43201 WP_001245277.1.43244 WP_001245277.1.4326 WP_001245277.1.43272 WP_001245277.1.43276 WP_001245277.1.43290 WP_001245277.1.43292 WP_001245277.1.43299 WP_001245277.1.43307 WP_001245277.1.43312 WP_001245277.1.43334 WP_001245277.1.43339 WP_001245277.1.43351 WP_001245277.1.43371 WP_001245277.1.43437 WP_001245277.1.4344 WP_001245277.1.43441 WP_001245277.1.43476 WP_001245277.1.43508 WP_001245277.1.43513 WP_001245277.1.43522 WP_001245277.1.43528 WP_001245277.1.43535 WP_001245277.1.43606 WP_001245277.1.43613 WP_001245277.1.43633 WP_001245277.1.43637 WP_001245277.1.43651 WP_001245277.1.43654 WP_001245277.1.43668 WP_001245277.1.43676 WP_001245277.1.43685 WP_001245277.1.43711 WP_001245277.1.43722 WP_001245277.1.4373 WP_001245277.1.43763 WP_001245277.1.43778 WP_001245277.1.43782 WP_001245277.1.43785 WP_001245277.1.43801 WP_001245277.1.43812 WP_001245277.1.43828 WP_001245277.1.43864 WP_001245277.1.43873 WP_001245277.1.43875 WP_001245277.1.43878 WP_001245277.1.43886 WP_001245277.1.43888 WP_001245277.1.43919 WP_001245277.1.43951 WP_001245277.1.43954 WP_001245277.1.43974 WP_001245277.1.44005 WP_001245277.1.44010 WP_001245277.1.4404 WP_001245277.1.44043 WP_001245277.1.44049 WP_001245277.1.4405 WP_001245277.1.44099 WP_001245277.1.44101 WP_001245277.1.44113 WP_001245277.1.44121 WP_001245277.1.44132 WP_001245277.1.44144 WP_001245277.1.44160 WP_001245277.1.44180 WP_001245277.1.44187 WP_001245277.1.44191 WP_001245277.1.44196 WP_001245277.1.44208 WP_001245277.1.44248 WP_001245277.1.44250 WP_001245277.1.44262 WP_001245277.1.44268 WP_001245277.1.4427 WP_001245277.1.44291 WP_001245277.1.44296 WP_001245277.1.44300 WP_001245277.1.44310 WP_001245277.1.44337 WP_001245277.1.44339 WP_001245277.1.44343 WP_001245277.1.44351 WP_001245277.1.44359 WP_001245277.1.44360 WP_001245277.1.44380 WP_001245277.1.44386 WP_001245277.1.44397 WP_001245277.1.4440 WP_001245277.1.44416 WP_001245277.1.44431 WP_001245277.1.44433 WP_001245277.1.44437 WP_001245277.1.44440 WP_001245277.1.44443 WP_001245277.1.44453 WP_001245277.1.44474 WP_001245277.1.44479 WP_001245277.1.44546 WP_001245277.1.44578 WP_001245277.1.44606 WP_001245277.1.44633 WP_001245277.1.44636 WP_001245277.1.44640 WP_001245277.1.4467 WP_001245277.1.44678 WP_001245277.1.4468 WP_001245277.1.44687 WP_001245277.1.44705 WP_001245277.1.44747 WP_001245277.1.44762 WP_001245277.1.44781 WP_001245277.1.44791 WP_001245277.1.44815 WP_001245277.1.44828 WP_001245277.1.44831 WP_001245277.1.44833 WP_001245277.1.4485 WP_001245277.1.44877 WP_001245277.1.44879 WP_001245277.1.44887 WP_001245277.1.449 WP_001245277.1.44917 WP_001245277.1.44927 WP_001245277.1.44933 WP_001245277.1.44943 WP_001245277.1.44950 WP_001245277.1.44966 WP_001245277.1.44971 WP_001245277.1.44978 WP_001245277.1.44985 WP_001245277.1.44996 WP_001245277.1.44997 WP_001245277.1.4500 WP_001245277.1.4501 WP_001245277.1.45038 WP_001245277.1.45045 WP_001245277.1.45067 WP_001245277.1.45072 WP_001245277.1.45074 WP_001245277.1.45079 WP_001245277.1.45093 WP_001245277.1.45098 WP_001245277.1.45123 WP_001245277.1.45134 WP_001245277.1.45136 WP_001245277.1.45138 WP_001245277.1.45145 WP_001245277.1.45173 WP_001245277.1.45177 WP_001245277.1.45184 WP_001245277.1.45241 WP_001245277.1.45251 WP_001245277.1.45259 WP_001245277.1.45268 WP_001245277.1.45302 WP_001245277.1.4531 WP_001245277.1.45344 WP_001245277.1.45349 WP_001245277.1.45351 WP_001245277.1.45365 WP_001245277.1.4540 WP_001245277.1.45402 WP_001245277.1.45432 WP_001245277.1.45434 WP_001245277.1.45435 WP_001245277.1.45462 WP_001245277.1.45468 WP_001245277.1.45522 WP_001245277.1.45523 WP_001245277.1.45544 WP_001245277.1.45549 WP_001245277.1.45550 WP_001245277.1.45569 WP_001245277.1.45571 WP_001245277.1.45582 WP_001245277.1.45583 WP_001245277.1.45585 WP_001245277.1.45596 WP_001245277.1.45622 WP_001245277.1.45648 WP_001245277.1.45660 WP_001245277.1.45690 WP_001245277.1.45706 WP_001245277.1.45781 WP_001245277.1.45797 WP_001245277.1.458 WP_001245277.1.45829 WP_001245277.1.45844 WP_001245277.1.45848 WP_001245277.1.45871 WP_001245277.1.45906 WP_001245277.1.45918 WP_001245277.1.4592 WP_001245277.1.45984 WP_001245277.1.46011 WP_001245277.1.46028 WP_001245277.1.46030 WP_001245277.1.46069 WP_001245277.1.46077 WP_001245277.1.46091 WP_001245277.1.46112 WP_001245277.1.46124 WP_001245277.1.46169 WP_001245277.1.46173 WP_001245277.1.46174 WP_001245277.1.46187 WP_001245277.1.46205 WP_001245277.1.46215 WP_001245277.1.46225 WP_001245277.1.46232 WP_001245277.1.46241 WP_001245277.1.46243 WP_001245277.1.46250 WP_001245277.1.46278 WP_001245277.1.46286 WP_001245277.1.46299 WP_001245277.1.46303 WP_001245277.1.46307 WP_001245277.1.46322 WP_001245277.1.46323 WP_001245277.1.46345 WP_001245277.1.46355 WP_001245277.1.46358 WP_001245277.1.464 WP_001245277.1.46406 WP_001245277.1.46434 WP_001245277.1.46444 WP_001245277.1.46454 WP_001245277.1.46461 WP_001245277.1.46504 WP_001245277.1.46505 WP_001245277.1.46551 WP_001245277.1.46559 WP_001245277.1.46572 WP_001245277.1.46574 WP_001245277.1.46578 WP_001245277.1.46595 WP_001245277.1.46620 WP_001245277.1.46637 WP_001245277.1.46666 WP_001245277.1.46675 WP_001245277.1.46689 WP_001245277.1.46693 WP_001245277.1.46701 WP_001245277.1.4671 WP_001245277.1.46726 WP_001245277.1.46730 WP_001245277.1.4674 WP_001245277.1.46781 WP_001245277.1.46803 WP_001245277.1.46804 WP_001245277.1.46816 WP_001245277.1.46842 WP_001245277.1.4686 WP_001245277.1.4690 WP_001245277.1.46920 WP_001245277.1.46930 WP_001245277.1.46945 WP_001245277.1.46961 WP_001245277.1.46967 WP_001245277.1.46975 WP_001245277.1.46976 WP_001245277.1.47005 WP_001245277.1.47008 WP_001245277.1.47023 WP_001245277.1.47036 WP_001245277.1.47037 WP_001245277.1.47042 WP_001245277.1.47057 WP_001245277.1.47059 WP_001245277.1.47061 WP_001245277.1.47085 WP_001245277.1.47110 WP_001245277.1.47123 WP_001245277.1.47214 WP_001245277.1.47215 WP_001245277.1.47245 WP_001245277.1.47257 WP_001245277.1.47389 WP_001245277.1.47429 WP_001245277.1.47442 WP_001245277.1.47448 WP_001245277.1.47460 WP_001245277.1.4747 WP_001245277.1.47472 WP_001245277.1.47478 WP_001245277.1.47482 WP_001245277.1.47492 WP_001245277.1.47506 WP_001245277.1.47507 WP_001245277.1.47523 WP_001245277.1.47531 WP_001245277.1.47532 WP_001245277.1.47542 WP_001245277.1.47567 WP_001245277.1.47576 WP_001245277.1.47579 WP_001245277.1.4758 WP_001245277.1.47587 WP_001245277.1.47605 WP_001245277.1.47614 WP_001245277.1.47621 WP_001245277.1.47630 WP_001245277.1.47649 WP_001245277.1.47660 WP_001245277.1.4769 WP_001245277.1.4770 WP_001245277.1.47714 WP_001245277.1.4774 WP_001245277.1.4775 WP_001245277.1.47756 WP_001245277.1.47767 WP_001245277.1.47799 WP_001245277.1.4781 WP_001245277.1.47814 WP_001245277.1.47817 WP_001245277.1.47829 WP_001245277.1.47850 WP_001245277.1.47875 WP_001245277.1.47886 WP_001245277.1.47898 WP_001245277.1.47911 WP_001245277.1.47928 WP_001245277.1.4795 WP_001245277.1.47988 WP_001245277.1.48019 WP_001245277.1.48100 WP_001245277.1.48114 WP_001245277.1.48124 WP_001245277.1.48132 WP_001245277.1.48139 WP_001245277.1.48190 WP_001245277.1.48209 WP_001245277.1.48215 WP_001245277.1.48242 WP_001245277.1.48244 WP_001245277.1.48253 WP_001245277.1.48262 WP_001245277.1.48268 WP_001245277.1.48292 WP_001245277.1.483 WP_001245277.1.48324 WP_001245277.1.48342 WP_001245277.1.48367 WP_001245277.1.48377 WP_001245277.1.4839 WP_001245277.1.48399 WP_001245277.1.48426 WP_001245277.1.48430 WP_001245277.1.48436 WP_001245277.1.48455 WP_001245277.1.48493 WP_001245277.1.48510 WP_001245277.1.48524 WP_001245277.1.4853 WP_001245277.1.48570 WP_001245277.1.48586 WP_001245277.1.4859 WP_001245277.1.48591 WP_001245277.1.48610 WP_001245277.1.48631 WP_001245277.1.48647 WP_001245277.1.48651 WP_001245277.1.48663 WP_001245277.1.48690 WP_001245277.1.48734 WP_001245277.1.48751 WP_001245277.1.48756 WP_001245277.1.48768 WP_001245277.1.48774 WP_001245277.1.48778 WP_001245277.1.48788 WP_001245277.1.48797 WP_001245277.1.48841 WP_001245277.1.48849 WP_001245277.1.4885 WP_001245277.1.48855 WP_001245277.1.48876 WP_001245277.1.48886 WP_001245277.1.48894 WP_001245277.1.48896 WP_001245277.1.48919 WP_001245277.1.48955 WP_001245277.1.48963 WP_001245277.1.48973 WP_001245277.1.48985 WP_001245277.1.49004 WP_001245277.1.49005 WP_001245277.1.49012 WP_001245277.1.49084 WP_001245277.1.49090 WP_001245277.1.49102 WP_001245277.1.49106 WP_001245277.1.49113 WP_001245277.1.49117 WP_001245277.1.49121 WP_001245277.1.4914 WP_001245277.1.49140 WP_001245277.1.49153 WP_001245277.1.49155 WP_001245277.1.49162 WP_001245277.1.49166 WP_001245277.1.49204 WP_001245277.1.49214 WP_001245277.1.49226 WP_001245277.1.49233 WP_001245277.1.49239 WP_001245277.1.49256 WP_001245277.1.49290 WP_001245277.1.49304 WP_001245277.1.49309 WP_001245277.1.49311 WP_001245277.1.49334 WP_001245277.1.49340 WP_001245277.1.49355 WP_001245277.1.49366 WP_001245277.1.49375 WP_001245277.1.49429 WP_001245277.1.49430 WP_001245277.1.49434 WP_001245277.1.49450 WP_001245277.1.49472 WP_001245277.1.49490 WP_001245277.1.49494 WP_001245277.1.495 WP_001245277.1.49515 WP_001245277.1.49545 WP_001245277.1.49550 WP_001245277.1.49572 WP_001245277.1.49574 WP_001245277.1.49590 WP_001245277.1.49595 WP_001245277.1.49602 WP_001245277.1.49626 WP_001245277.1.49630 WP_001245277.1.49686 WP_001245277.1.49703 WP_001245277.1.49769 WP_001245277.1.49770 WP_001245277.1.4979 WP_001245277.1.49790 WP_001245277.1.49803 WP_001245277.1.49805 WP_001245277.1.49827 WP_001245277.1.49846 WP_001245277.1.49848 WP_001245277.1.4991 WP_001245277.1.49929 WP_001245277.1.49931 WP_001245277.1.49947 WP_001245277.1.49959 WP_001245277.1.49997 WP_001245277.1.50003 WP_001245277.1.50007 WP_001245277.1.50014 WP_001245277.1.50030 WP_001245277.1.50043 WP_001245277.1.50080 WP_001245277.1.5009 WP_001245277.1.50103 WP_001245277.1.50128 WP_001245277.1.50153 WP_001245277.1.50158 WP_001245277.1.50161 WP_001245277.1.50198 WP_001245277.1.50211 WP_001245277.1.50239 WP_001245277.1.50247 WP_001245277.1.50251 WP_001245277.1.50308 WP_001245277.1.50309 WP_001245277.1.50332 WP_001245277.1.50376 WP_001245277.1.50387 WP_001245277.1.50389 WP_001245277.1.50404 WP_001245277.1.50406 WP_001245277.1.50413 WP_001245277.1.50449 WP_001245277.1.50468 WP_001245277.1.50469 WP_001245277.1.50478 WP_001245277.1.50497 WP_001245277.1.5051 WP_001245277.1.50517 WP_001245277.1.50563 WP_001245277.1.50565 WP_001245277.1.50566 WP_001245277.1.50570 WP_001245277.1.50576 WP_001245277.1.5058 WP_001245277.1.50593 WP_001245277.1.50626 WP_001245277.1.50652 WP_001245277.1.50676 WP_001245277.1.50684 WP_001245277.1.50726 WP_001245277.1.50750 WP_001245277.1.50769 WP_001245277.1.50771 WP_001245277.1.50774 WP_001245277.1.50777 WP_001245277.1.50782 WP_001245277.1.50804 WP_001245277.1.50808 WP_001245277.1.50811 WP_001245277.1.50875 WP_001245277.1.5088 WP_001245277.1.50882 WP_001245277.1.50885 WP_001245277.1.509 WP_001245277.1.50905 WP_001245277.1.50908 WP_001245277.1.50918 WP_001245277.1.50929 WP_001245277.1.50941 WP_001245277.1.50954 WP_001245277.1.50960 WP_001245277.1.50970 WP_001245277.1.50999 WP_001245277.1.51014 WP_001245277.1.51022 WP_001245277.1.51025 WP_001245277.1.51036 WP_001245277.1.51040 WP_001245277.1.51048 WP_001245277.1.51066 WP_001245277.1.51100 WP_001245277.1.51117 WP_001245277.1.51134 WP_001245277.1.51139 WP_001245277.1.5114 WP_001245277.1.51162 WP_001245277.1.51179 WP_001245277.1.51182 WP_001245277.1.51186 WP_001245277.1.51224 WP_001245277.1.51227 WP_001245277.1.5125 WP_001245277.1.5127 WP_001245277.1.51285 WP_001245277.1.51305 WP_001245277.1.51308 WP_001245277.1.51315 WP_001245277.1.51331 WP_001245277.1.51338 WP_001245277.1.51356 WP_001245277.1.5136 WP_001245277.1.5138 WP_001245277.1.51412 WP_001245277.1.51414 WP_001245277.1.51419 WP_001245277.1.51451 WP_001245277.1.51464 WP_001245277.1.51474 WP_001245277.1.51487 WP_001245277.1.51488 WP_001245277.1.51502 WP_001245277.1.51506 WP_001245277.1.51514 WP_001245277.1.51518 WP_001245277.1.51519 WP_001245277.1.51555 WP_001245277.1.51594 WP_001245277.1.51598 WP_001245277.1.51611 WP_001245277.1.51634 WP_001245277.1.51642 WP_001245277.1.51644 WP_001245277.1.51649 WP_001245277.1.51686 WP_001245277.1.51704 WP_001245277.1.51724 WP_001245277.1.51734 WP_001245277.1.51756 WP_001245277.1.51764 WP_001245277.1.51810 WP_001245277.1.51831 WP_001245277.1.51838 WP_001245277.1.51841 WP_001245277.1.5185 WP_001245277.1.51863 WP_001245277.1.51868 WP_001245277.1.51900 WP_001245277.1.51910 WP_001245277.1.51911 WP_001245277.1.51930 WP_001245277.1.51932 WP_001245277.1.51935 WP_001245277.1.51989 WP_001245277.1.51994 WP_001245277.1.520 WP_001245277.1.52047 WP_001245277.1.52057 WP_001245277.1.52101 WP_001245277.1.5211 WP_001245277.1.52114 WP_001245277.1.52121 WP_001245277.1.52123 WP_001245277.1.52129 WP_001245277.1.52148 WP_001245277.1.52156 WP_001245277.1.5216 WP_001245277.1.52170 WP_001245277.1.52191 WP_001245277.1.52202 WP_001245277.1.52209 WP_001245277.1.52255 WP_001245277.1.52301 WP_001245277.1.52321 WP_001245277.1.52336 WP_001245277.1.52339 WP_001245277.1.52346 WP_001245277.1.52353 WP_001245277.1.52356 WP_001245277.1.52361 WP_001245277.1.52438 WP_001245277.1.52446 WP_001245277.1.52456 WP_001245277.1.52469 WP_001245277.1.52527 WP_001245277.1.52528 WP_001245277.1.52571 WP_001245277.1.52582 WP_001245277.1.52586 WP_001245277.1.526 WP_001245277.1.52608 WP_001245277.1.52637 WP_001245277.1.52647 WP_001245277.1.52653 WP_001245277.1.52656 WP_001245277.1.52692 WP_001245277.1.52738 WP_001245277.1.52742 WP_001245277.1.52743 WP_001245277.1.52744 WP_001245277.1.52773 WP_001245277.1.52795 WP_001245277.1.52807 WP_001245277.1.52833 WP_001245277.1.52851 WP_001245277.1.52857 WP_001245277.1.52866 WP_001245277.1.52887 WP_001245277.1.52898 WP_001245277.1.52915 WP_001245277.1.52924 WP_001245277.1.52949 WP_001245277.1.52985 WP_001245277.1.53016 WP_001245277.1.53092 WP_001245277.1.53100 WP_001245277.1.53107 WP_001245277.1.53119 WP_001245277.1.5313 WP_001245277.1.53141 WP_001245277.1.53151 WP_001245277.1.53154 WP_001245277.1.53158 WP_001245277.1.53159 WP_001245277.1.53190 WP_001245277.1.53198 WP_001245277.1.53206 WP_001245277.1.53210 WP_001245277.1.53233 WP_001245277.1.53234 WP_001245277.1.53272 WP_001245277.1.53286 WP_001245277.1.53307 WP_001245277.1.53315 WP_001245277.1.53316 WP_001245277.1.53321 WP_001245277.1.53328 WP_001245277.1.5333 WP_001245277.1.53362 WP_001245277.1.53368 WP_001245277.1.53375 WP_001245277.1.53385 WP_001245277.1.53406 WP_001245277.1.53436 WP_001245277.1.53450 WP_001245277.1.53454 WP_001245277.1.53466 WP_001245277.1.5349 WP_001245277.1.53529 WP_001245277.1.53540 WP_001245277.1.53543 WP_001245277.1.53555 WP_001245277.1.53559 WP_001245277.1.5356 WP_001245277.1.53567 WP_001245277.1.53571 WP_001245277.1.5358 WP_001245277.1.53664 WP_001245277.1.53688 WP_001245277.1.53692 WP_001245277.1.53694 WP_001245277.1.53723 WP_001245277.1.5374 WP_001245277.1.53750 WP_001245277.1.53757 WP_001245277.1.53778 WP_001245277.1.53781 WP_001245277.1.53790 WP_001245277.1.53800 WP_001245277.1.53812 WP_001245277.1.53814 WP_001245277.1.53815 WP_001245277.1.53839 WP_001245277.1.53892 WP_001245277.1.53896 WP_001245277.1.53898 WP_001245277.1.53902 WP_001245277.1.53905 WP_001245277.1.5392 WP_001245277.1.53935 WP_001245277.1.53958 WP_001245277.1.53961 WP_001245277.1.53981 WP_001245277.1.53984 WP_001245277.1.54033 WP_001245277.1.54061 WP_001245277.1.54068 WP_001245277.1.54075 WP_001245277.1.54082 WP_001245277.1.54085 WP_001245277.1.54132 WP_001245277.1.54136 WP_001245277.1.5415 WP_001245277.1.54170 WP_001245277.1.54175 WP_001245277.1.54196 WP_001245277.1.542 WP_001245277.1.54203 WP_001245277.1.54209 WP_001245277.1.54259 WP_001245277.1.54271 WP_001245277.1.54273 WP_001245277.1.54274 WP_001245277.1.54283 WP_001245277.1.5430 WP_001245277.1.54319 WP_001245277.1.54324 WP_001245277.1.54340 WP_001245277.1.54364 WP_001245277.1.54366 WP_001245277.1.54371 WP_001245277.1.54400 WP_001245277.1.54431 WP_001245277.1.54442 WP_001245277.1.54469 WP_001245277.1.54482 WP_001245277.1.54522 WP_001245277.1.54526 WP_001245277.1.54558 WP_001245277.1.5456 WP_001245277.1.54569 WP_001245277.1.54589 WP_001245277.1.54607 WP_001245277.1.54615 WP_001245277.1.5462 WP_001245277.1.54644 WP_001245277.1.54662 WP_001245277.1.54667 WP_001245277.1.54678 WP_001245277.1.54681 WP_001245277.1.54722 WP_001245277.1.54748 WP_001245277.1.54749 WP_001245277.1.54764 WP_001245277.1.5481 WP_001245277.1.54814 WP_001245277.1.54822 WP_001245277.1.54827 WP_001245277.1.54833 WP_001245277.1.54845 WP_001245277.1.54865 WP_001245277.1.54877 WP_001245277.1.5493 WP_001245277.1.54935 WP_001245277.1.54936 WP_001245277.1.54979 WP_001245277.1.54992 WP_001245277.1.55008 WP_001245277.1.55010 WP_001245277.1.55034 WP_001245277.1.55073 WP_001245277.1.55152 WP_001245277.1.55156 WP_001245277.1.55163 WP_001245277.1.55165 WP_001245277.1.55166 WP_001245277.1.5517 WP_001245277.1.55178 WP_001245277.1.55215 WP_001245277.1.55223 WP_001245277.1.55224 WP_001245277.1.5527 WP_001245277.1.55285 WP_001245277.1.55290 WP_001245277.1.55310 WP_001245277.1.55317 WP_001245277.1.55325 WP_001245277.1.55379 WP_001245277.1.5539 WP_001245277.1.55418 WP_001245277.1.55430 WP_001245277.1.55468 WP_001245277.1.55475 WP_001245277.1.55506 WP_001245277.1.5552 WP_001245277.1.55528 WP_001245277.1.55545 WP_001245277.1.55554 WP_001245277.1.55557 WP_001245277.1.55559 WP_001245277.1.5560 WP_001245277.1.55604 WP_001245277.1.55614 WP_001245277.1.55623 WP_001245277.1.55639 WP_001245277.1.55640 WP_001245277.1.55647 WP_001245277.1.55699 WP_001245277.1.5572 WP_001245277.1.55725 WP_001245277.1.55743 WP_001245277.1.55768 WP_001245277.1.5577 WP_001245277.1.55780 WP_001245277.1.55782 WP_001245277.1.55796 WP_001245277.1.55803 WP_001245277.1.55853 WP_001245277.1.55923 WP_001245277.1.55948 WP_001245277.1.55967 WP_001245277.1.55973 WP_001245277.1.55993 WP_001245277.1.55995 WP_001245277.1.56002 WP_001245277.1.56004 WP_001245277.1.56012 WP_001245277.1.56026 WP_001245277.1.56069 WP_001245277.1.56070 WP_001245277.1.56082 WP_001245277.1.56097 WP_001245277.1.56100 WP_001245277.1.56105 WP_001245277.1.56144 WP_001245277.1.56172 WP_001245277.1.5621 WP_001245277.1.56222 WP_001245277.1.56226 WP_001245277.1.56235 WP_001245277.1.56238 WP_001245277.1.56244 WP_001245277.1.56247 WP_001245277.1.56261 WP_001245277.1.56263 WP_001245277.1.56286 WP_001245277.1.56303 WP_001245277.1.56304 WP_001245277.1.56305 WP_001245277.1.56311 WP_001245277.1.5633 WP_001245277.1.56354 WP_001245277.1.56368 WP_001245277.1.56370 WP_001245277.1.56374 WP_001245277.1.56385 WP_001245277.1.56393 WP_001245277.1.56396 WP_001245277.1.56413 WP_001245277.1.56414 WP_001245277.1.56419 WP_001245277.1.56423 WP_001245277.1.56438 WP_001245277.1.56468 WP_001245277.1.56514 WP_001245277.1.56535 WP_001245277.1.56559 WP_001245277.1.56560 WP_001245277.1.56585 WP_001245277.1.56597 WP_001245277.1.56601 WP_001245277.1.56614 WP_001245277.1.56615 WP_001245277.1.56640 WP_001245277.1.56647 WP_001245277.1.56660 WP_001245277.1.56671 WP_001245277.1.5668 WP_001245277.1.56682 WP_001245277.1.56724 WP_001245277.1.56791 WP_001245277.1.56824 WP_001245277.1.56825 WP_001245277.1.56851 WP_001245277.1.56853 WP_001245277.1.56861 WP_001245277.1.56877 WP_001245277.1.56887 WP_001245277.1.56889 WP_001245277.1.56893 WP_001245277.1.56898 WP_001245277.1.56905 WP_001245277.1.56942 WP_001245277.1.56950 WP_001245277.1.56981 WP_001245277.1.57000 WP_001245277.1.57026 WP_001245277.1.57039 WP_001245277.1.57056 WP_001245277.1.57076 WP_001245277.1.57084 WP_001245277.1.57101 WP_001245277.1.5711 WP_001245277.1.57137 WP_001245277.1.57143 WP_001245277.1.57147 WP_001245277.1.57149 WP_001245277.1.57168 WP_001245277.1.57179 WP_001245277.1.57186 WP_001245277.1.57187 WP_001245277.1.57232 WP_001245277.1.57244 WP_001245277.1.57246 WP_001245277.1.57296 WP_001245277.1.57307 WP_001245277.1.57342 WP_001245277.1.57356 WP_001245277.1.57357 WP_001245277.1.57362 WP_001245277.1.57377 WP_001245277.1.57399 WP_001245277.1.57418 WP_001245277.1.57433 WP_001245277.1.57495 WP_001245277.1.57510 WP_001245277.1.57515 WP_001245277.1.57529 WP_001245277.1.5753 WP_001245277.1.57534 WP_001245277.1.57559 WP_001245277.1.57576 WP_001245277.1.57601 WP_001245277.1.57607 WP_001245277.1.5761 WP_001245277.1.57631 WP_001245277.1.57641 WP_001245277.1.57684 WP_001245277.1.57699 WP_001245277.1.57710 WP_001245277.1.57735 WP_001245277.1.5774 WP_001245277.1.57763 WP_001245277.1.57781 WP_001245277.1.57785 WP_001245277.1.57800 WP_001245277.1.57835 WP_001245277.1.57857 WP_001245277.1.57862 WP_001245277.1.57873 WP_001245277.1.57890 WP_001245277.1.57891 WP_001245277.1.57893 WP_001245277.1.57902 WP_001245277.1.57965 WP_001245277.1.57972 WP_001245277.1.57978 WP_001245277.1.58008 WP_001245277.1.5801 WP_001245277.1.58040 WP_001245277.1.58041 WP_001245277.1.58044 WP_001245277.1.58081 WP_001245277.1.5809 WP_001245277.1.58090 WP_001245277.1.58131 WP_001245277.1.58132 WP_001245277.1.58157 WP_001245277.1.58173 WP_001245277.1.58191 WP_001245277.1.58194 WP_001245277.1.58239 WP_001245277.1.58249 WP_001245277.1.58252 WP_001245277.1.58261 WP_001245277.1.58274 WP_001245277.1.5828 WP_001245277.1.58282 WP_001245277.1.58290 WP_001245277.1.58301 WP_001245277.1.58324 WP_001245277.1.58326 WP_001245277.1.58334 WP_001245277.1.58357 WP_001245277.1.58358 WP_001245277.1.5836 WP_001245277.1.58372 WP_001245277.1.58407 WP_001245277.1.58416 WP_001245277.1.58418 WP_001245277.1.58443 WP_001245277.1.58451 WP_001245277.1.58467 WP_001245277.1.58485 WP_001245277.1.58486 WP_001245277.1.58489 WP_001245277.1.58537 WP_001245277.1.5854 WP_001245277.1.58548 WP_001245277.1.58564 WP_001245277.1.58568 WP_001245277.1.5858 WP_001245277.1.58583 WP_001245277.1.58652 WP_001245277.1.58662 WP_001245277.1.58663 WP_001245277.1.58669 WP_001245277.1.58675 WP_001245277.1.58698 WP_001245277.1.587 WP_001245277.1.58724 WP_001245277.1.58744 WP_001245277.1.58745 WP_001245277.1.58749 WP_001245277.1.5875 WP_001245277.1.5878 WP_001245277.1.58796 WP_001245277.1.58803 WP_001245277.1.58807 WP_001245277.1.58831 WP_001245277.1.58834 WP_001245277.1.58847 WP_001245277.1.5886 WP_001245277.1.58883 WP_001245277.1.58884 WP_001245277.1.58898 WP_001245277.1.58926 WP_001245277.1.58932 WP_001245277.1.58949 WP_001245277.1.58963 WP_001245277.1.58970 WP_001245277.1.58974 WP_001245277.1.59006 WP_001245277.1.59020 WP_001245277.1.59043 WP_001245277.1.59056 WP_001245277.1.59061 WP_001245277.1.59064 WP_001245277.1.59068 WP_001245277.1.59084 WP_001245277.1.59094 WP_001245277.1.59097 WP_001245277.1.59125 WP_001245277.1.59142 WP_001245277.1.59148 WP_001245277.1.59163 WP_001245277.1.59224 WP_001245277.1.59236 WP_001245277.1.59282 WP_001245277.1.5929 WP_001245277.1.59294 WP_001245277.1.59299 WP_001245277.1.59313 WP_001245277.1.59321 WP_001245277.1.59335 WP_001245277.1.59336 WP_001245277.1.59375 WP_001245277.1.59381 WP_001245277.1.59420 WP_001245277.1.59427 WP_001245277.1.59439 WP_001245277.1.59458 WP_001245277.1.5949 WP_001245277.1.59490 WP_001245277.1.59501 WP_001245277.1.59508 WP_001245277.1.59510 WP_001245277.1.59512 WP_001245277.1.59521 WP_001245277.1.5953 WP_001245277.1.59538 WP_001245277.1.59548 WP_001245277.1.59604 WP_001245277.1.59636 WP_001245277.1.59641 WP_001245277.1.59646 WP_001245277.1.59648 WP_001245277.1.59684 WP_001245277.1.5969 WP_001245277.1.59694 WP_001245277.1.59709 WP_001245277.1.59710 WP_001245277.1.59751 WP_001245277.1.59755 WP_001245277.1.59771 WP_001245277.1.5979 WP_001245277.1.59827 WP_001245277.1.59829 WP_001245277.1.59830 WP_001245277.1.59847 WP_001245277.1.59848 WP_001245277.1.59863 WP_001245277.1.59928 WP_001245277.1.5993 WP_001245277.1.59953 WP_001245277.1.59969 WP_001245277.1.59979 WP_001245277.1.59994 WP_001245277.1.60004 WP_001245277.1.60008 WP_001245277.1.60015 WP_001245277.1.60021 WP_001245277.1.60045 WP_001245277.1.60052 WP_001245277.1.60069 WP_001245277.1.60076 WP_001245277.1.60106 WP_001245277.1.60114 WP_001245277.1.60126 WP_001245277.1.60137 WP_001245277.1.60140 WP_001245277.1.60154 WP_001245277.1.60155 WP_001245277.1.60168 WP_001245277.1.60192 WP_001245277.1.60199 WP_001245277.1.60209 WP_001245277.1.60212 WP_001245277.1.60213 WP_001245277.1.60226 WP_001245277.1.60253 WP_001245277.1.60285 WP_001245277.1.60320 WP_001245277.1.60322 WP_001245277.1.60324 WP_001245277.1.6033 WP_001245277.1.60330 WP_001245277.1.60356 WP_001245277.1.60379 WP_001245277.1.6038 WP_001245277.1.60380 WP_001245277.1.6041 WP_001245277.1.60424 WP_001245277.1.60425 WP_001245277.1.60464 WP_001245277.1.60481 WP_001245277.1.60486 WP_001245277.1.605 WP_001245277.1.60503 WP_001245277.1.60507 WP_001245277.1.6052 WP_001245277.1.60545 WP_001245277.1.60560 WP_001245277.1.60561 WP_001245277.1.6058 WP_001245277.1.60584 WP_001245277.1.6060 WP_001245277.1.60608 WP_001245277.1.60622 WP_001245277.1.60643 WP_001245277.1.60661 WP_001245277.1.60676 WP_001245277.1.60708 WP_001245277.1.60713 WP_001245277.1.60725 WP_001245277.1.60746 WP_001245277.1.60760 WP_001245277.1.60772 WP_001245277.1.60783 WP_001245277.1.60792 WP_001245277.1.608 WP_001245277.1.60807 WP_001245277.1.60809 WP_001245277.1.60838 WP_001245277.1.60855 WP_001245277.1.60863 WP_001245277.1.60866 WP_001245277.1.60874 WP_001245277.1.60882 WP_001245277.1.60889 WP_001245277.1.60897 WP_001245277.1.6090 WP_001245277.1.60918 WP_001245277.1.60919 WP_001245277.1.60926 WP_001245277.1.60941 WP_001245277.1.60950 WP_001245277.1.60990 WP_001245277.1.6104 WP_001245277.1.61044 WP_001245277.1.61045 WP_001245277.1.61076 WP_001245277.1.61078 WP_001245277.1.6108 WP_001245277.1.61087 WP_001245277.1.61114 WP_001245277.1.61123 WP_001245277.1.6114 WP_001245277.1.61146 WP_001245277.1.61147 WP_001245277.1.61168 WP_001245277.1.61184 WP_001245277.1.61200 WP_001245277.1.61201 WP_001245277.1.61210 WP_001245277.1.61232 WP_001245277.1.61233 WP_001245277.1.6129 WP_001245277.1.61296 WP_001245277.1.61309 WP_001245277.1.61345 WP_001245277.1.61356 WP_001245277.1.61357 WP_001245277.1.61381 WP_001245277.1.61417 WP_001245277.1.6143 WP_001245277.1.61501 WP_001245277.1.61509 WP_001245277.1.61511 WP_001245277.1.61519 WP_001245277.1.61539 WP_001245277.1.61542 WP_001245277.1.61553 WP_001245277.1.61574 WP_001245277.1.61594 WP_001245277.1.61595 WP_001245277.1.61609 WP_001245277.1.6164 WP_001245277.1.61649 WP_001245277.1.61652 WP_001245277.1.61667 WP_001245277.1.61671 WP_001245277.1.61694 WP_001245277.1.61697 WP_001245277.1.61712 WP_001245277.1.61714 WP_001245277.1.61730 WP_001245277.1.61732 WP_001245277.1.61737 WP_001245277.1.61809 WP_001245277.1.61857 WP_001245277.1.61877 WP_001245277.1.6190 WP_001245277.1.61908 WP_001245277.1.61918 WP_001245277.1.61920 WP_001245277.1.61922 WP_001245277.1.61924 WP_001245277.1.61952 WP_001245277.1.62007 WP_001245277.1.62020 WP_001245277.1.62025 WP_001245277.1.62063 WP_001245277.1.62076 WP_001245277.1.6209 WP_001245277.1.6210 WP_001245277.1.62124 WP_001245277.1.62144 WP_001245277.1.62158 WP_001245277.1.62184 WP_001245277.1.62195 WP_001245277.1.62199 WP_001245277.1.62201 WP_001245277.1.62204 WP_001245277.1.62210 WP_001245277.1.62219 WP_001245277.1.62222 WP_001245277.1.62223 WP_001245277.1.62241 WP_001245277.1.62245 WP_001245277.1.62257 WP_001245277.1.62271 WP_001245277.1.62302 WP_001245277.1.62304 WP_001245277.1.62314 WP_001245277.1.62323 WP_001245277.1.62333 WP_001245277.1.62338 WP_001245277.1.62339 WP_001245277.1.62344 WP_001245277.1.62361 WP_001245277.1.62364 WP_001245277.1.62374 WP_001245277.1.62380 WP_001245277.1.62403 WP_001245277.1.62404 WP_001245277.1.62411 WP_001245277.1.62412 WP_001245277.1.62436 WP_001245277.1.62475 WP_001245277.1.62486 WP_001245277.1.62488 WP_001245277.1.62504 WP_001245277.1.6253 WP_001245277.1.62536 WP_001245277.1.62570 WP_001245277.1.62619 WP_001245277.1.62640 WP_001245277.1.62648 WP_001245277.1.62677 WP_001245277.1.62686 WP_001245277.1.62693 WP_001245277.1.627 WP_001245277.1.62725 WP_001245277.1.62745 WP_001245277.1.62751 WP_001245277.1.62757 WP_001245277.1.62798 WP_001245277.1.62825 WP_001245277.1.62853 WP_001245277.1.62903 WP_001245277.1.62910 WP_001245277.1.62913 WP_001245277.1.6292 WP_001245277.1.62932 WP_001245277.1.62955 WP_001245277.1.62960 WP_001245277.1.62983 WP_001245277.1.62988 WP_001245277.1.63016 WP_001245277.1.63025 WP_001245277.1.63043 WP_001245277.1.63045 WP_001245277.1.63063 WP_001245277.1.63069 WP_001245277.1.63087 WP_001245277.1.63102 WP_001245277.1.63118 WP_001245277.1.63129 WP_001245277.1.63135 WP_001245277.1.63150 WP_001245277.1.63155 WP_001245277.1.63169 WP_001245277.1.63181 WP_001245277.1.63186 WP_001245277.1.63203 WP_001245277.1.63229 WP_001245277.1.63234 WP_001245277.1.63250 WP_001245277.1.63256 WP_001245277.1.63290 WP_001245277.1.63297 WP_001245277.1.63358 WP_001245277.1.63382 WP_001245277.1.63422 WP_001245277.1.63448 WP_001245277.1.63461 WP_001245277.1.63479 WP_001245277.1.63497 WP_001245277.1.63499 WP_001245277.1.63509 WP_001245277.1.63514 WP_001245277.1.63525 WP_001245277.1.63529 WP_001245277.1.63532 WP_001245277.1.63568 WP_001245277.1.63577 WP_001245277.1.63583 WP_001245277.1.63585 WP_001245277.1.63592 WP_001245277.1.63603 WP_001245277.1.63633 WP_001245277.1.63663 WP_001245277.1.63664 WP_001245277.1.6367 WP_001245277.1.63677 WP_001245277.1.63690 WP_001245277.1.6370 WP_001245277.1.63718 WP_001245277.1.63731 WP_001245277.1.63736 WP_001245277.1.63748 WP_001245277.1.6375 WP_001245277.1.63757 WP_001245277.1.63782 WP_001245277.1.63797 WP_001245277.1.63816 WP_001245277.1.63824 WP_001245277.1.63831 WP_001245277.1.63834 WP_001245277.1.63851 WP_001245277.1.63860 WP_001245277.1.63863 WP_001245277.1.63866 WP_001245277.1.63876 WP_001245277.1.6389 WP_001245277.1.63901 WP_001245277.1.63903 WP_001245277.1.63912 WP_001245277.1.63934 WP_001245277.1.63955 WP_001245277.1.63958 WP_001245277.1.63963 WP_001245277.1.63977 WP_001245277.1.6399 WP_001245277.1.63992 WP_001245277.1.64007 WP_001245277.1.64010 WP_001245277.1.64018 WP_001245277.1.64032 WP_001245277.1.64034 WP_001245277.1.64046 WP_001245277.1.64072 WP_001245277.1.64085 WP_001245277.1.64087 WP_001245277.1.64109 WP_001245277.1.64121 WP_001245277.1.6415 WP_001245277.1.64157 WP_001245277.1.64217 WP_001245277.1.64229 WP_001245277.1.6423 WP_001245277.1.64242 WP_001245277.1.64244 WP_001245277.1.64266 WP_001245277.1.64293 WP_001245277.1.64332 WP_001245277.1.64350 WP_001245277.1.6437 WP_001245277.1.64374 WP_001245277.1.64376 WP_001245277.1.64385 WP_001245277.1.64387 WP_001245277.1.64389 WP_001245277.1.644 WP_001245277.1.64403 WP_001245277.1.64412 WP_001245277.1.64462 WP_001245277.1.64471 WP_001245277.1.64500 WP_001245277.1.64501 WP_001245277.1.6451 WP_001245277.1.64538 WP_001245277.1.64569 WP_001245277.1.64597 WP_001245277.1.64632 WP_001245277.1.64648 WP_001245277.1.64649 WP_001245277.1.64654 WP_001245277.1.64662 WP_001245277.1.64663 WP_001245277.1.64667 WP_001245277.1.64674 WP_001245277.1.64690 WP_001245277.1.64702 WP_001245277.1.64709 WP_001245277.1.64710 WP_001245277.1.64711 WP_001245277.1.64744 WP_001245277.1.64757 WP_001245277.1.64763 WP_001245277.1.64781 WP_001245277.1.64798 WP_001245277.1.64817 WP_001245277.1.64831 WP_001245277.1.64847 WP_001245277.1.6487 WP_001245277.1.6489 WP_001245277.1.64891 WP_001245277.1.64894 WP_001245277.1.64920 WP_001245277.1.64944 WP_001245277.1.64974 WP_001245277.1.65011 WP_001245277.1.65016 WP_001245277.1.65018 WP_001245277.1.65022 WP_001245277.1.65027 WP_001245277.1.65028 WP_001245277.1.65052 WP_001245277.1.65054 WP_001245277.1.65075 WP_001245277.1.6514 WP_001245277.1.65163 WP_001245277.1.65171 WP_001245277.1.65172 WP_001245277.1.65185 WP_001245277.1.65191 WP_001245277.1.65200 WP_001245277.1.65211 WP_001245277.1.65218 WP_001245277.1.65226 WP_001245277.1.65248 WP_001245277.1.65249 WP_001245277.1.65266 WP_001245277.1.65269 WP_001245277.1.6535 WP_001245277.1.65357 WP_001245277.1.65363 WP_001245277.1.65394 WP_001245277.1.65395 WP_001245277.1.65459 WP_001245277.1.65463 WP_001245277.1.65474 WP_001245277.1.65475 WP_001245277.1.65487 WP_001245277.1.6549 WP_001245277.1.65499 WP_001245277.1.65508 WP_001245277.1.6554 WP_001245277.1.65558 WP_001245277.1.65572 WP_001245277.1.6560 WP_001245277.1.65601 WP_001245277.1.6561 WP_001245277.1.65633 WP_001245277.1.6565 WP_001245277.1.65650 WP_001245277.1.65687 WP_001245277.1.65696 WP_001245277.1.65697 WP_001245277.1.65698 WP_001245277.1.65699 WP_001245277.1.6572 WP_001245277.1.65737 WP_001245277.1.6575 WP_001245277.1.65755 WP_001245277.1.65771 WP_001245277.1.65782 WP_001245277.1.65790 WP_001245277.1.65795 WP_001245277.1.65812 WP_001245277.1.65818 WP_001245277.1.65838 WP_001245277.1.65846 WP_001245277.1.65849 WP_001245277.1.65863 WP_001245277.1.65876 WP_001245277.1.65881 WP_001245277.1.65883 WP_001245277.1.65901 WP_001245277.1.6594 WP_001245277.1.65940 WP_001245277.1.65945 WP_001245277.1.6595 WP_001245277.1.65956 WP_001245277.1.65985 WP_001245277.1.66021 WP_001245277.1.66031 WP_001245277.1.66049 WP_001245277.1.66052 WP_001245277.1.66064 WP_001245277.1.66074 WP_001245277.1.66109 WP_001245277.1.66122 WP_001245277.1.66145 WP_001245277.1.66167 WP_001245277.1.66171 WP_001245277.1.66183 WP_001245277.1.6620 WP_001245277.1.66216 WP_001245277.1.66234 WP_001245277.1.66235 WP_001245277.1.66270 WP_001245277.1.66273 WP_001245277.1.66289 WP_001245277.1.6630 WP_001245277.1.66314 WP_001245277.1.66315 WP_001245277.1.66324 WP_001245277.1.66330 WP_001245277.1.6634 WP_001245277.1.66358 WP_001245277.1.66361 WP_001245277.1.66362 WP_001245277.1.6638 WP_001245277.1.66385 WP_001245277.1.6640 WP_001245277.1.66400 WP_001245277.1.66428 WP_001245277.1.66446 WP_001245277.1.66462 WP_001245277.1.66480 WP_001245277.1.66492 WP_001245277.1.66506 WP_001245277.1.66534 WP_001245277.1.66539 WP_001245277.1.66600 WP_001245277.1.66630 WP_001245277.1.66665 WP_001245277.1.66678 WP_001245277.1.66681 WP_001245277.1.66684 WP_001245277.1.66698 WP_001245277.1.66733 WP_001245277.1.66755 WP_001245277.1.66759 WP_001245277.1.66779 WP_001245277.1.6680 WP_001245277.1.66801 WP_001245277.1.66807 WP_001245277.1.66820 WP_001245277.1.66824 WP_001245277.1.66834 WP_001245277.1.66860 WP_001245277.1.66901 WP_001245277.1.6692 WP_001245277.1.66937 WP_001245277.1.66953 WP_001245277.1.66955 WP_001245277.1.66959 WP_001245277.1.66962 WP_001245277.1.66981 WP_001245277.1.67 WP_001245277.1.67024 WP_001245277.1.67037 WP_001245277.1.67042 WP_001245277.1.67045 WP_001245277.1.67075 WP_001245277.1.6710 WP_001245277.1.67100 WP_001245277.1.67101 WP_001245277.1.67143 WP_001245277.1.67173 WP_001245277.1.67181 WP_001245277.1.67184 WP_001245277.1.67201 WP_001245277.1.67211 WP_001245277.1.67228 WP_001245277.1.67235 WP_001245277.1.67237 WP_001245277.1.67268 WP_001245277.1.67279 WP_001245277.1.67288 WP_001245277.1.67336 WP_001245277.1.67339 WP_001245277.1.67347 WP_001245277.1.67374 WP_001245277.1.67387 WP_001245277.1.6739 WP_001245277.1.67394 WP_001245277.1.67397 WP_001245277.1.67403 WP_001245277.1.67405 WP_001245277.1.67424 WP_001245277.1.67430 WP_001245277.1.67442 WP_001245277.1.67465 WP_001245277.1.67539 WP_001245277.1.67552 WP_001245277.1.67556 WP_001245277.1.67576 WP_001245277.1.6760 WP_001245277.1.67603 WP_001245277.1.67604 WP_001245277.1.67619 WP_001245277.1.67625 WP_001245277.1.67627 WP_001245277.1.67637 WP_001245277.1.67641 WP_001245277.1.67657 WP_001245277.1.67673 WP_001245277.1.67682 WP_001245277.1.67700 WP_001245277.1.67707 WP_001245277.1.67718 WP_001245277.1.67729 WP_001245277.1.67772 WP_001245277.1.67774 WP_001245277.1.67776 WP_001245277.1.67803 WP_001245277.1.67814 WP_001245277.1.6782 WP_001245277.1.67820 WP_001245277.1.67825 WP_001245277.1.67827 WP_001245277.1.67829 WP_001245277.1.6785 WP_001245277.1.67887 WP_001245277.1.67910 WP_001245277.1.67924 WP_001245277.1.67932 WP_001245277.1.67942 WP_001245277.1.67954 WP_001245277.1.67969 WP_001245277.1.68 WP_001245277.1.68036 WP_001245277.1.68043 WP_001245277.1.68073 WP_001245277.1.6809 WP_001245277.1.68105 WP_001245277.1.68113 WP_001245277.1.68131 WP_001245277.1.68140 WP_001245277.1.68147 WP_001245277.1.68159 WP_001245277.1.68182 WP_001245277.1.6819 WP_001245277.1.68201 WP_001245277.1.68206 WP_001245277.1.6827 WP_001245277.1.68275 WP_001245277.1.68285 WP_001245277.1.6833 WP_001245277.1.68359 WP_001245277.1.68401 WP_001245277.1.68420 WP_001245277.1.68477 WP_001245277.1.68478 WP_001245277.1.6849 WP_001245277.1.685 WP_001245277.1.68514 WP_001245277.1.68532 WP_001245277.1.68547 WP_001245277.1.68564 WP_001245277.1.6857 WP_001245277.1.68589 WP_001245277.1.68652 WP_001245277.1.68655 WP_001245277.1.68656 WP_001245277.1.68658 WP_001245277.1.68677 WP_001245277.1.68688 WP_001245277.1.6869 WP_001245277.1.68690 WP_001245277.1.68742 WP_001245277.1.6875 WP_001245277.1.68770 WP_001245277.1.68778 WP_001245277.1.68787 WP_001245277.1.68809 WP_001245277.1.68818 WP_001245277.1.6882 WP_001245277.1.68893 WP_001245277.1.68894 WP_001245277.1.68895 WP_001245277.1.68914 WP_001245277.1.68928 WP_001245277.1.68958 WP_001245277.1.68966 WP_001245277.1.68975 WP_001245277.1.68999 WP_001245277.1.69001 WP_001245277.1.69006 WP_001245277.1.69011 WP_001245277.1.69029 WP_001245277.1.6904 WP_001245277.1.69042 WP_001245277.1.69053 WP_001245277.1.69080 WP_001245277.1.69086 WP_001245277.1.6913 WP_001245277.1.69131 WP_001245277.1.69146 WP_001245277.1.69151 WP_001245277.1.69170 WP_001245277.1.69210 WP_001245277.1.69236 WP_001245277.1.69255 WP_001245277.1.69270 WP_001245277.1.69273 WP_001245277.1.69282 WP_001245277.1.69288 WP_001245277.1.69296 WP_001245277.1.69346 WP_001245277.1.69357 WP_001245277.1.69359 WP_001245277.1.69371 WP_001245277.1.69376 WP_001245277.1.69396 WP_001245277.1.69397 WP_001245277.1.69433 WP_001245277.1.69465 WP_001245277.1.69466 WP_001245277.1.69485 WP_001245277.1.6954 WP_001245277.1.69554 WP_001245277.1.69564 WP_001245277.1.69575 WP_001245277.1.69588 WP_001245277.1.69611 WP_001245277.1.69616 WP_001245277.1.69636 WP_001245277.1.69642 WP_001245277.1.69644 WP_001245277.1.69656 WP_001245277.1.69657 WP_001245277.1.69690 WP_001245277.1.69696 WP_001245277.1.69704 WP_001245277.1.69754 WP_001245277.1.69758 WP_001245277.1.69767 WP_001245277.1.69785 WP_001245277.1.69787 WP_001245277.1.69790 WP_001245277.1.69808 WP_001245277.1.69839 WP_001245277.1.69848 WP_001245277.1.69890 WP_001245277.1.69923 WP_001245277.1.69948 WP_001245277.1.69953 WP_001245277.1.69965 WP_001245277.1.69975 WP_001245277.1.69977 WP_001245277.1.70003 WP_001245277.1.70010 WP_001245277.1.70028 WP_001245277.1.70049 WP_001245277.1.70058 WP_001245277.1.70061 WP_001245277.1.70088 WP_001245277.1.7010 WP_001245277.1.7014 WP_001245277.1.70169 WP_001245277.1.70183 WP_001245277.1.70205 WP_001245277.1.7021 WP_001245277.1.70240 WP_001245277.1.70241 WP_001245277.1.70248 WP_001245277.1.70249 WP_001245277.1.70261 WP_001245277.1.70269 WP_001245277.1.70272 WP_001245277.1.70281 WP_001245277.1.70289 WP_001245277.1.70290 WP_001245277.1.70303 WP_001245277.1.70314 WP_001245277.1.70321 WP_001245277.1.70326 WP_001245277.1.70327 WP_001245277.1.7033 WP_001245277.1.70355 WP_001245277.1.70427 WP_001245277.1.70433 WP_001245277.1.7044 WP_001245277.1.70440 WP_001245277.1.70447 WP_001245277.1.70485 WP_001245277.1.70488 WP_001245277.1.70523 WP_001245277.1.70531 WP_001245277.1.70545 WP_001245277.1.70547 WP_001245277.1.70580 WP_001245277.1.70596 WP_001245277.1.7060 WP_001245277.1.70623 WP_001245277.1.70643 WP_001245277.1.70644 WP_001245277.1.70662 WP_001245277.1.70671 WP_001245277.1.70678 WP_001245277.1.70679 WP_001245277.1.70683 WP_001245277.1.70708 WP_001245277.1.70717 WP_001245277.1.70731 WP_001245277.1.70733 WP_001245277.1.70761 WP_001245277.1.70772 WP_001245277.1.70785 WP_001245277.1.70792 WP_001245277.1.70797 WP_001245277.1.70837 WP_001245277.1.70845 WP_001245277.1.70846 WP_001245277.1.70869 WP_001245277.1.70883 WP_001245277.1.70899 WP_001245277.1.70914 WP_001245277.1.70922 WP_001245277.1.70929 WP_001245277.1.7093 WP_001245277.1.70948 WP_001245277.1.70959 WP_001245277.1.70969 WP_001245277.1.70971 WP_001245277.1.70977 WP_001245277.1.70981 WP_001245277.1.70985 WP_001245277.1.70986 WP_001245277.1.70995 WP_001245277.1.71007 WP_001245277.1.71010 WP_001245277.1.71023 WP_001245277.1.71039 WP_001245277.1.71057 WP_001245277.1.71069 WP_001245277.1.71081 WP_001245277.1.71088 WP_001245277.1.7110 WP_001245277.1.71116 WP_001245277.1.71117 WP_001245277.1.71120 WP_001245277.1.71146 WP_001245277.1.71165 WP_001245277.1.71172 WP_001245277.1.71184 WP_001245277.1.71186 WP_001245277.1.71188 WP_001245277.1.71201 WP_001245277.1.71202 WP_001245277.1.71243 WP_001245277.1.71248 WP_001245277.1.71268 WP_001245277.1.71299 WP_001245277.1.71305 WP_001245277.1.71306 WP_001245277.1.71337 WP_001245277.1.7134 WP_001245277.1.71363 WP_001245277.1.71378 WP_001245277.1.714 WP_001245277.1.71401 WP_001245277.1.71407 WP_001245277.1.71418 WP_001245277.1.7142 WP_001245277.1.71446 WP_001245277.1.71450 WP_001245277.1.71455 WP_001245277.1.71456 WP_001245277.1.71481 WP_001245277.1.71487 WP_001245277.1.71500 WP_001245277.1.71523 WP_001245277.1.71542 WP_001245277.1.71566 WP_001245277.1.71583 WP_001245277.1.71626 WP_001245277.1.71636 WP_001245277.1.71640 WP_001245277.1.71649 WP_001245277.1.71651 WP_001245277.1.71653 WP_001245277.1.71656 WP_001245277.1.71658 WP_001245277.1.71691 WP_001245277.1.71702 WP_001245277.1.71716 WP_001245277.1.7174 WP_001245277.1.71750 WP_001245277.1.71756 WP_001245277.1.71798 WP_001245277.1.71845 WP_001245277.1.71848 WP_001245277.1.71872 WP_001245277.1.71881 WP_001245277.1.71908 WP_001245277.1.71950 WP_001245277.1.71952 WP_001245277.1.71954 WP_001245277.1.71973 WP_001245277.1.71979 WP_001245277.1.71984 WP_001245277.1.71985 WP_001245277.1.720 WP_001245277.1.72003 WP_001245277.1.72065 WP_001245277.1.72073 WP_001245277.1.72100 WP_001245277.1.72105 WP_001245277.1.72107 WP_001245277.1.72119 WP_001245277.1.72121 WP_001245277.1.72182 WP_001245277.1.72188 WP_001245277.1.72190 WP_001245277.1.72203 WP_001245277.1.72221 WP_001245277.1.72226 WP_001245277.1.72234 WP_001245277.1.72243 WP_001245277.1.72254 WP_001245277.1.72269 WP_001245277.1.72277 WP_001245277.1.72281 WP_001245277.1.72300 WP_001245277.1.72307 WP_001245277.1.72325 WP_001245277.1.72339 WP_001245277.1.72350 WP_001245277.1.72351 WP_001245277.1.72372 WP_001245277.1.72376 WP_001245277.1.72382 WP_001245277.1.72383 WP_001245277.1.72403 WP_001245277.1.72412 WP_001245277.1.72438 WP_001245277.1.72461 WP_001245277.1.72470 WP_001245277.1.72527 WP_001245277.1.72532 WP_001245277.1.7255 WP_001245277.1.72594 WP_001245277.1.72602 WP_001245277.1.72625 WP_001245277.1.72629 WP_001245277.1.72631 WP_001245277.1.72638 WP_001245277.1.72642 WP_001245277.1.72667 WP_001245277.1.72671 WP_001245277.1.72674 WP_001245277.1.72689 WP_001245277.1.72716 WP_001245277.1.72718 WP_001245277.1.72724 WP_001245277.1.72789 WP_001245277.1.72793 WP_001245277.1.72797 WP_001245277.1.72827 WP_001245277.1.72828 WP_001245277.1.72843 WP_001245277.1.72850 WP_001245277.1.72865 WP_001245277.1.72871 WP_001245277.1.72872 WP_001245277.1.72894 WP_001245277.1.72896 WP_001245277.1.72897 WP_001245277.1.72946 WP_001245277.1.7295 WP_001245277.1.72969 WP_001245277.1.72975 WP_001245277.1.72987 WP_001245277.1.7304 WP_001245277.1.73052 WP_001245277.1.73062 WP_001245277.1.73068 WP_001245277.1.73102 WP_001245277.1.7311 WP_001245277.1.73114 WP_001245277.1.73125 WP_001245277.1.73144 WP_001245277.1.7315 WP_001245277.1.73164 WP_001245277.1.73177 WP_001245277.1.73180 WP_001245277.1.73200 WP_001245277.1.73258 WP_001245277.1.73270 WP_001245277.1.73285 WP_001245277.1.7332 WP_001245277.1.7333 WP_001245277.1.7334 WP_001245277.1.73352 WP_001245277.1.73362 WP_001245277.1.73377 WP_001245277.1.73379 WP_001245277.1.73389 WP_001245277.1.7341 WP_001245277.1.73425 WP_001245277.1.73461 WP_001245277.1.73481 WP_001245277.1.73488 WP_001245277.1.73504 WP_001245277.1.73512 WP_001245277.1.7353 WP_001245277.1.73535 WP_001245277.1.73544 WP_001245277.1.7356 WP_001245277.1.73561 WP_001245277.1.73581 WP_001245277.1.73598 WP_001245277.1.7361 WP_001245277.1.73617 WP_001245277.1.73648 WP_001245277.1.73667 WP_001245277.1.73701 WP_001245277.1.73708 WP_001245277.1.73753 WP_001245277.1.73758 WP_001245277.1.73764 WP_001245277.1.73768 WP_001245277.1.73794 WP_001245277.1.73804 WP_001245277.1.73831 WP_001245277.1.73847 WP_001245277.1.73849 WP_001245277.1.7387 WP_001245277.1.73924 WP_001245277.1.73926 WP_001245277.1.7394 WP_001245277.1.73945 WP_001245277.1.73948 WP_001245277.1.73965 WP_001245277.1.73999 WP_001245277.1.74024 WP_001245277.1.74029 WP_001245277.1.74030 WP_001245277.1.74038 WP_001245277.1.74040 WP_001245277.1.74043 WP_001245277.1.74049 WP_001245277.1.74058 WP_001245277.1.74070 WP_001245277.1.74077 WP_001245277.1.74089 WP_001245277.1.74117 WP_001245277.1.74135 WP_001245277.1.74174 WP_001245277.1.74181 WP_001245277.1.74191 WP_001245277.1.74207 WP_001245277.1.74214 WP_001245277.1.74241 WP_001245277.1.74248 WP_001245277.1.74285 WP_001245277.1.743 WP_001245277.1.7430 WP_001245277.1.74300 WP_001245277.1.74317 WP_001245277.1.7433 WP_001245277.1.74379 WP_001245277.1.74402 WP_001245277.1.74410 WP_001245277.1.74414 WP_001245277.1.74415 WP_001245277.1.7444 WP_001245277.1.74454 WP_001245277.1.74466 WP_001245277.1.74469 WP_001245277.1.74481 WP_001245277.1.745 WP_001245277.1.74500 WP_001245277.1.74529 WP_001245277.1.74545 WP_001245277.1.74570 WP_001245277.1.74578 WP_001245277.1.7458 WP_001245277.1.74616 WP_001245277.1.74620 WP_001245277.1.74621 WP_001245277.1.74639 WP_001245277.1.74644 WP_001245277.1.74647 WP_001245277.1.74661 WP_001245277.1.74677 WP_001245277.1.74699 WP_001245277.1.74702 WP_001245277.1.74741 WP_001245277.1.74745 WP_001245277.1.74757 WP_001245277.1.74806 WP_001245277.1.74807 WP_001245277.1.74826 WP_001245277.1.74831 WP_001245277.1.74876 WP_001245277.1.74884 WP_001245277.1.74894 WP_001245277.1.7491 WP_001245277.1.74929 WP_001245277.1.74939 WP_001245277.1.74972 WP_001245277.1.74973 WP_001245277.1.74992 WP_001245277.1.74996 WP_001245277.1.75009 WP_001245277.1.75051 WP_001245277.1.75056 WP_001245277.1.75058 WP_001245277.1.7507 WP_001245277.1.75089 WP_001245277.1.75114 WP_001245277.1.75116 WP_001245277.1.75129 WP_001245277.1.75148 WP_001245277.1.75159 WP_001245277.1.75168 WP_001245277.1.75180 WP_001245277.1.75187 WP_001245277.1.75237 WP_001245277.1.75273 WP_001245277.1.75288 WP_001245277.1.75296 WP_001245277.1.75301 WP_001245277.1.75334 WP_001245277.1.75362 WP_001245277.1.75371 WP_001245277.1.75385 WP_001245277.1.75392 WP_001245277.1.75400 WP_001245277.1.75402 WP_001245277.1.75413 WP_001245277.1.7543 WP_001245277.1.75433 WP_001245277.1.75450 WP_001245277.1.75494 WP_001245277.1.75532 WP_001245277.1.75565 WP_001245277.1.7558 WP_001245277.1.75585 WP_001245277.1.75593 WP_001245277.1.75607 WP_001245277.1.75609 WP_001245277.1.75610 WP_001245277.1.75626 WP_001245277.1.75633 WP_001245277.1.75716 WP_001245277.1.75718 WP_001245277.1.75740 WP_001245277.1.75745 WP_001245277.1.75751 WP_001245277.1.75760 WP_001245277.1.75764 WP_001245277.1.75793 WP_001245277.1.75794 WP_001245277.1.75810 WP_001245277.1.75828 WP_001245277.1.75837 WP_001245277.1.75844 WP_001245277.1.75863 WP_001245277.1.75874 WP_001245277.1.75886 WP_001245277.1.75898 WP_001245277.1.75902 WP_001245277.1.75932 WP_001245277.1.75945 WP_001245277.1.76020 WP_001245277.1.76055 WP_001245277.1.76081 WP_001245277.1.76097 WP_001245277.1.76102 WP_001245277.1.76108 WP_001245277.1.76115 WP_001245277.1.76116 WP_001245277.1.76122 WP_001245277.1.76137 WP_001245277.1.76156 WP_001245277.1.76162 WP_001245277.1.76170 WP_001245277.1.76208 WP_001245277.1.76252 WP_001245277.1.76256 WP_001245277.1.76301 WP_001245277.1.76327 WP_001245277.1.7633 WP_001245277.1.76339 WP_001245277.1.7634 WP_001245277.1.76345 WP_001245277.1.76364 WP_001245277.1.76366 WP_001245277.1.76417 WP_001245277.1.76434 WP_001245277.1.76445 WP_001245277.1.76451 WP_001245277.1.7646 WP_001245277.1.76471 WP_001245277.1.76495 WP_001245277.1.76510 WP_001245277.1.76529 WP_001245277.1.76532 WP_001245277.1.76548 WP_001245277.1.76558 WP_001245277.1.76572 WP_001245277.1.76576 WP_001245277.1.7660 WP_001245277.1.76611 WP_001245277.1.76641 WP_001245277.1.76651 WP_001245277.1.76653 WP_001245277.1.76673 WP_001245277.1.76706 WP_001245277.1.7672 WP_001245277.1.76721 WP_001245277.1.76738 WP_001245277.1.76756 WP_001245277.1.76760 WP_001245277.1.76776 WP_001245277.1.76788 WP_001245277.1.76799 WP_001245277.1.76806 WP_001245277.1.7684 WP_001245277.1.76854 WP_001245277.1.76866 WP_001245277.1.76875 WP_001245277.1.76880 WP_001245277.1.76899 WP_001245277.1.76913 WP_001245277.1.76916 WP_001245277.1.76932 WP_001245277.1.76968 WP_001245277.1.76973 WP_001245277.1.76988 WP_001245277.1.77016 WP_001245277.1.77017 WP_001245277.1.77033 WP_001245277.1.77038 WP_001245277.1.77047 WP_001245277.1.77067 WP_001245277.1.77080 WP_001245277.1.77087 WP_001245277.1.77090 WP_001245277.1.77111 WP_001245277.1.7712 WP_001245277.1.77177 WP_001245277.1.77180 WP_001245277.1.77241 WP_001245277.1.77244 WP_001245277.1.77267 WP_001245277.1.77271 WP_001245277.1.77292 WP_001245277.1.77299 WP_001245277.1.77306 WP_001245277.1.77313 WP_001245277.1.77349 WP_001245277.1.77356 WP_001245277.1.77384 WP_001245277.1.77390 WP_001245277.1.77414 WP_001245277.1.77436 WP_001245277.1.77475 WP_001245277.1.77496 WP_001245277.1.77501 WP_001245277.1.77512 WP_001245277.1.77513 WP_001245277.1.77514 WP_001245277.1.77529 WP_001245277.1.77543 WP_001245277.1.77549 WP_001245277.1.77555 WP_001245277.1.77563 WP_001245277.1.77565 WP_001245277.1.77575 WP_001245277.1.77596 WP_001245277.1.77646 WP_001245277.1.77692 WP_001245277.1.77702 WP_001245277.1.77710 WP_001245277.1.77713 WP_001245277.1.7772 WP_001245277.1.77729 WP_001245277.1.77754 WP_001245277.1.7782 WP_001245277.1.77825 WP_001245277.1.77837 WP_001245277.1.7784 WP_001245277.1.77846 WP_001245277.1.77851 WP_001245277.1.77871 WP_001245277.1.77898 WP_001245277.1.77900 WP_001245277.1.77918 WP_001245277.1.7792 WP_001245277.1.77923 WP_001245277.1.7793 WP_001245277.1.77951 WP_001245277.1.77960 WP_001245277.1.77971 WP_001245277.1.77975 WP_001245277.1.77983 WP_001245277.1.77987 WP_001245277.1.77989 WP_001245277.1.78 WP_001245277.1.7802 WP_001245277.1.78026 WP_001245277.1.78033 WP_001245277.1.78035 WP_001245277.1.78048 WP_001245277.1.78051 WP_001245277.1.78053 WP_001245277.1.78076 WP_001245277.1.78096 WP_001245277.1.78100 WP_001245277.1.78107 WP_001245277.1.78110 WP_001245277.1.78120 WP_001245277.1.7814 WP_001245277.1.78166 WP_001245277.1.78168 WP_001245277.1.78170 WP_001245277.1.78192 WP_001245277.1.78195 WP_001245277.1.78201 WP_001245277.1.78245 WP_001245277.1.78291 WP_001245277.1.78301 WP_001245277.1.78309 WP_001245277.1.78320 WP_001245277.1.78352 WP_001245277.1.78372 WP_001245277.1.78382 WP_001245277.1.78383 WP_001245277.1.78388 WP_001245277.1.78407 WP_001245277.1.78410 WP_001245277.1.78443 WP_001245277.1.78501 WP_001245277.1.78602 WP_001245277.1.78603 WP_001245277.1.7861 WP_001245277.1.78618 WP_001245277.1.7862 WP_001245277.1.78626 WP_001245277.1.78632 WP_001245277.1.78658 WP_001245277.1.78661 WP_001245277.1.78673 WP_001245277.1.78674 WP_001245277.1.78676 WP_001245277.1.78697 WP_001245277.1.78715 WP_001245277.1.78734 WP_001245277.1.78735 WP_001245277.1.78738 WP_001245277.1.78761 WP_001245277.1.7877 WP_001245277.1.78771 WP_001245277.1.78789 WP_001245277.1.78802 WP_001245277.1.78815 WP_001245277.1.78830 WP_001245277.1.78835 WP_001245277.1.78838 WP_001245277.1.78871 WP_001245277.1.78874 WP_001245277.1.78877 WP_001245277.1.78881 WP_001245277.1.78896 WP_001245277.1.789 WP_001245277.1.78913 WP_001245277.1.78918 WP_001245277.1.78928 WP_001245277.1.78930 WP_001245277.1.78951 WP_001245277.1.78959 WP_001245277.1.78993 WP_001245277.1.79011 WP_001245277.1.79012 WP_001245277.1.79032 WP_001245277.1.79069 WP_001245277.1.79074 WP_001245277.1.79098 WP_001245277.1.79099 WP_001245277.1.79140 WP_001245277.1.79151 WP_001245277.1.79155 WP_001245277.1.79164 WP_001245277.1.79167 WP_001245277.1.79203 WP_001245277.1.79204 WP_001245277.1.79235 WP_001245277.1.79280 WP_001245277.1.79289 WP_001245277.1.79297 WP_001245277.1.79302 WP_001245277.1.79335 WP_001245277.1.79397 WP_001245277.1.794 WP_001245277.1.79427 WP_001245277.1.79456 WP_001245277.1.79462 WP_001245277.1.79468 WP_001245277.1.79472 WP_001245277.1.79490 WP_001245277.1.79495 WP_001245277.1.79529 WP_001245277.1.79532 WP_001245277.1.79547 WP_001245277.1.7956 WP_001245277.1.79570 WP_001245277.1.79580 WP_001245277.1.79586 WP_001245277.1.79635 WP_001245277.1.7964 WP_001245277.1.79654 WP_001245277.1.79659 WP_001245277.1.79668 WP_001245277.1.7970 WP_001245277.1.79708 WP_001245277.1.7972 WP_001245277.1.79722 WP_001245277.1.79734 WP_001245277.1.79738 WP_001245277.1.79757 WP_001245277.1.79772 WP_001245277.1.7979 WP_001245277.1.7982 WP_001245277.1.79845 WP_001245277.1.79867 WP_001245277.1.79880 WP_001245277.1.79892 WP_001245277.1.7991 WP_001245277.1.79910 WP_001245277.1.79914 WP_001245277.1.79916 WP_001245277.1.79929 WP_001245277.1.79934 WP_001245277.1.7994 WP_001245277.1.79951 WP_001245277.1.79966 WP_001245277.1.79974 WP_001245277.1.79996 WP_001245277.1.80045 WP_001245277.1.80065 WP_001245277.1.80077 WP_001245277.1.80103 WP_001245277.1.80137 WP_001245277.1.80182 WP_001245277.1.80236 WP_001245277.1.8024 WP_001245277.1.80249 WP_001245277.1.80254 WP_001245277.1.80273 WP_001245277.1.80282 WP_001245277.1.80293 WP_001245277.1.80296 WP_001245277.1.80307 WP_001245277.1.80354 WP_001245277.1.80366 WP_001245277.1.80368 WP_001245277.1.80380 WP_001245277.1.80386 WP_001245277.1.80400 WP_001245277.1.80441 WP_001245277.1.80462 WP_001245277.1.80473 WP_001245277.1.80479 WP_001245277.1.80480 WP_001245277.1.8049 WP_001245277.1.80492 WP_001245277.1.80496 WP_001245277.1.80529 WP_001245277.1.80569 WP_001245277.1.80586 WP_001245277.1.80651 WP_001245277.1.80664 WP_001245277.1.80667 WP_001245277.1.80674 WP_001245277.1.80696 WP_001245277.1.80723 WP_001245277.1.80725 WP_001245277.1.80741 WP_001245277.1.80750 WP_001245277.1.80757 WP_001245277.1.80760 WP_001245277.1.80780 WP_001245277.1.80803 WP_001245277.1.80827 WP_001245277.1.80831 WP_001245277.1.80850 WP_001245277.1.80868 WP_001245277.1.80874 WP_001245277.1.80876 WP_001245277.1.80881 WP_001245277.1.80913 WP_001245277.1.80939 WP_001245277.1.80959 WP_001245277.1.8096 WP_001245277.1.80984 WP_001245277.1.81037 WP_001245277.1.81041 WP_001245277.1.8106 WP_001245277.1.81069 WP_001245277.1.81084 WP_001245277.1.81107 WP_001245277.1.81109 WP_001245277.1.81110 WP_001245277.1.81118 WP_001245277.1.81131 WP_001245277.1.81149 WP_001245277.1.81175 WP_001245277.1.81187 WP_001245277.1.8119 WP_001245277.1.81193 WP_001245277.1.81197 WP_001245277.1.81225 WP_001245277.1.81262 WP_001245277.1.81268 WP_001245277.1.81269 WP_001245277.1.8127 WP_001245277.1.81271 WP_001245277.1.8130 WP_001245277.1.81305 WP_001245277.1.8131 WP_001245277.1.81320 WP_001245277.1.81321 WP_001245277.1.81328 WP_001245277.1.81333 WP_001245277.1.8134 WP_001245277.1.81342 WP_001245277.1.81354 WP_001245277.1.81364 WP_001245277.1.81388 WP_001245277.1.81404 WP_001245277.1.81410 WP_001245277.1.81425 WP_001245277.1.81455 WP_001245277.1.81472 WP_001245277.1.81494 WP_001245277.1.81504 WP_001245277.1.81528 WP_001245277.1.81557 WP_001245277.1.81568 WP_001245277.1.81667 WP_001245277.1.81668 WP_001245277.1.81676 WP_001245277.1.81681 WP_001245277.1.8170 WP_001245277.1.81727 WP_001245277.1.81735 WP_001245277.1.81736 WP_001245277.1.81743 WP_001245277.1.81750 WP_001245277.1.81760 WP_001245277.1.81763 WP_001245277.1.81768 WP_001245277.1.81785 WP_001245277.1.81855 WP_001245277.1.81902 WP_001245277.1.81921 WP_001245277.1.81931 WP_001245277.1.81936 WP_001245277.1.81941 WP_001245277.1.81949 WP_001245277.1.8196 WP_001245277.1.81965 WP_001245277.1.81974 WP_001245277.1.81995 WP_001245277.1.82037 WP_001245277.1.82070 WP_001245277.1.82076 WP_001245277.1.82131 WP_001245277.1.82141 WP_001245277.1.82149 WP_001245277.1.82156 WP_001245277.1.8218 WP_001245277.1.82180 WP_001245277.1.82192 WP_001245277.1.82201 WP_001245277.1.82214 WP_001245277.1.82225 WP_001245277.1.82232 WP_001245277.1.82269 WP_001245277.1.82337 WP_001245277.1.82347 WP_001245277.1.82395 WP_001245277.1.8240 WP_001245277.1.82401 WP_001245277.1.82408 WP_001245277.1.82416 WP_001245277.1.8242 WP_001245277.1.82420 WP_001245277.1.82434 WP_001245277.1.82456 WP_001245277.1.82464 WP_001245277.1.82465 WP_001245277.1.8247 WP_001245277.1.82473 WP_001245277.1.82474 WP_001245277.1.82479 WP_001245277.1.82503 WP_001245277.1.82515 WP_001245277.1.82529 WP_001245277.1.82553 WP_001245277.1.82562 WP_001245277.1.82569 WP_001245277.1.82584 WP_001245277.1.82646 WP_001245277.1.82670 WP_001245277.1.82676 WP_001245277.1.82692 WP_001245277.1.82731 WP_001245277.1.82761 WP_001245277.1.82763 WP_001245277.1.82812 WP_001245277.1.8282 WP_001245277.1.82841 WP_001245277.1.82843 WP_001245277.1.82850 WP_001245277.1.82867 WP_001245277.1.82872 WP_001245277.1.82886 WP_001245277.1.82895 WP_001245277.1.82908 WP_001245277.1.82937 WP_001245277.1.8294 WP_001245277.1.82944 WP_001245277.1.82946 WP_001245277.1.82956 WP_001245277.1.82959 WP_001245277.1.82964 WP_001245277.1.82992 WP_001245277.1.83005 WP_001245277.1.83006 WP_001245277.1.83007 WP_001245277.1.8304 WP_001245277.1.83061 WP_001245277.1.83092 WP_001245277.1.83119 WP_001245277.1.83139 WP_001245277.1.83163 WP_001245277.1.83180 WP_001245277.1.83204 WP_001245277.1.83229 WP_001245277.1.83235 WP_001245277.1.83258 WP_001245277.1.83280 WP_001245277.1.83290 WP_001245277.1.83301 WP_001245277.1.83305 WP_001245277.1.83331 WP_001245277.1.83333 WP_001245277.1.83354 WP_001245277.1.83356 WP_001245277.1.83365 WP_001245277.1.83378 WP_001245277.1.83382 WP_001245277.1.83413 WP_001245277.1.83491 WP_001245277.1.83510 WP_001245277.1.83516 WP_001245277.1.83523 WP_001245277.1.8354 WP_001245277.1.83558 WP_001245277.1.83598 WP_001245277.1.83650 WP_001245277.1.83651 WP_001245277.1.83657 WP_001245277.1.83677 WP_001245277.1.83710 WP_001245277.1.83721 WP_001245277.1.83739 WP_001245277.1.8375 WP_001245277.1.83759 WP_001245277.1.83760 WP_001245277.1.83854 WP_001245277.1.83897 WP_001245277.1.83923 WP_001245277.1.83960 WP_001245277.1.83979 WP_001245277.1.8399 WP_001245277.1.83994 WP_001245277.1.83995 WP_001245277.1.84 WP_001245277.1.84000 WP_001245277.1.84011 WP_001245277.1.84031 WP_001245277.1.8406 WP_001245277.1.84075 WP_001245277.1.84076 WP_001245277.1.84083 WP_001245277.1.84086 WP_001245277.1.84103 WP_001245277.1.84106 WP_001245277.1.84110 WP_001245277.1.84115 WP_001245277.1.84127 WP_001245277.1.84150 WP_001245277.1.84154 WP_001245277.1.84168 WP_001245277.1.84179 WP_001245277.1.84209 WP_001245277.1.84230 WP_001245277.1.8425 WP_001245277.1.84252 WP_001245277.1.84283 WP_001245277.1.84291 WP_001245277.1.84300 WP_001245277.1.8431 WP_001245277.1.84325 WP_001245277.1.84345 WP_001245277.1.84355 WP_001245277.1.84359 WP_001245277.1.84369 WP_001245277.1.84373 WP_001245277.1.84392 WP_001245277.1.84397 WP_001245277.1.84401 WP_001245277.1.8441 WP_001245277.1.84435 WP_001245277.1.84459 WP_001245277.1.84461 WP_001245277.1.84475 WP_001245277.1.84497 WP_001245277.1.84515 WP_001245277.1.84523 WP_001245277.1.84532 WP_001245277.1.84551 WP_001245277.1.84554 WP_001245277.1.84567 WP_001245277.1.84572 WP_001245277.1.84598 WP_001245277.1.84631 WP_001245277.1.84644 WP_001245277.1.84659 WP_001245277.1.84683 WP_001245277.1.84693 WP_001245277.1.84711 WP_001245277.1.84721 WP_001245277.1.84727 WP_001245277.1.84744 WP_001245277.1.84745 WP_001245277.1.84773 WP_001245277.1.84814 WP_001245277.1.84872 WP_001245277.1.84876 WP_001245277.1.84879 WP_001245277.1.84899 WP_001245277.1.849 WP_001245277.1.84945 WP_001245277.1.84967 WP_001245277.1.8497 WP_001245277.1.84983 WP_001245277.1.85004 WP_001245277.1.85014 WP_001245277.1.8502 WP_001245277.1.85039 WP_001245277.1.85040 WP_001245277.1.85079 WP_001245277.1.85120 WP_001245277.1.85126 WP_001245277.1.85134 WP_001245277.1.85147 WP_001245277.1.85153 WP_001245277.1.85178 WP_001245277.1.85180 WP_001245277.1.85190 WP_001245277.1.85192 WP_001245277.1.85217 WP_001245277.1.8526 WP_001245277.1.85271 WP_001245277.1.85273 WP_001245277.1.85301 WP_001245277.1.8533 WP_001245277.1.85338 WP_001245277.1.85339 WP_001245277.1.8537 WP_001245277.1.85408 WP_001245277.1.8545 WP_001245277.1.85456 WP_001245277.1.85469 WP_001245277.1.85481 WP_001245277.1.85483 WP_001245277.1.85511 WP_001245277.1.85512 WP_001245277.1.8552 WP_001245277.1.85541 WP_001245277.1.8556 WP_001245277.1.85568 WP_001245277.1.8557 WP_001245277.1.85606 WP_001245277.1.85615 WP_001245277.1.85617 WP_001245277.1.85635 WP_001245277.1.85646 WP_001245277.1.85663 WP_001245277.1.85665 WP_001245277.1.85669 WP_001245277.1.85671 WP_001245277.1.85672 WP_001245277.1.85675 WP_001245277.1.85688 WP_001245277.1.85728 WP_001245277.1.85742 WP_001245277.1.85746 WP_001245277.1.85759 WP_001245277.1.85777 WP_001245277.1.85780 WP_001245277.1.85784 WP_001245277.1.85797 WP_001245277.1.85811 WP_001245277.1.85854 WP_001245277.1.85855 WP_001245277.1.85864 WP_001245277.1.85886 WP_001245277.1.859 WP_001245277.1.85900 WP_001245277.1.85904 WP_001245277.1.85917 WP_001245277.1.8594 WP_001245277.1.85976 WP_001245277.1.85977 WP_001245277.1.85982 WP_001245277.1.860 WP_001245277.1.86007 WP_001245277.1.86017 WP_001245277.1.86043 WP_001245277.1.8605 WP_001245277.1.86084 WP_001245277.1.86092 WP_001245277.1.8610 WP_001245277.1.86120 WP_001245277.1.86138 WP_001245277.1.8614 WP_001245277.1.86156 WP_001245277.1.86157 WP_001245277.1.86159 WP_001245277.1.8616 WP_001245277.1.86173 WP_001245277.1.86224 WP_001245277.1.86240 WP_001245277.1.86259 WP_001245277.1.86284 WP_001245277.1.86306 WP_001245277.1.86310 WP_001245277.1.86316 WP_001245277.1.86323 WP_001245277.1.86335 WP_001245277.1.86342 WP_001245277.1.86347 WP_001245277.1.86356 WP_001245277.1.86380 WP_001245277.1.86389 WP_001245277.1.8640 WP_001245277.1.8642 WP_001245277.1.86426 WP_001245277.1.86442 WP_001245277.1.86450 WP_001245277.1.86453 WP_001245277.1.86466 WP_001245277.1.86469 WP_001245277.1.8647 WP_001245277.1.86489 WP_001245277.1.86514 WP_001245277.1.86530 WP_001245277.1.86580 WP_001245277.1.86588 WP_001245277.1.86593 WP_001245277.1.86601 WP_001245277.1.86610 WP_001245277.1.86634 WP_001245277.1.86656 WP_001245277.1.86658 WP_001245277.1.86661 WP_001245277.1.86663 WP_001245277.1.86676 WP_001245277.1.8671 WP_001245277.1.8672 WP_001245277.1.86770 WP_001245277.1.8678 WP_001245277.1.86794 WP_001245277.1.86800 WP_001245277.1.86807 WP_001245277.1.86810 WP_001245277.1.86811 WP_001245277.1.86815 WP_001245277.1.8684 WP_001245277.1.86859 WP_001245277.1.86860 WP_001245277.1.86895 WP_001245277.1.86906 WP_001245277.1.8691 WP_001245277.1.86915 WP_001245277.1.86945 WP_001245277.1.86982 WP_001245277.1.86989 WP_001245277.1.87023 WP_001245277.1.87034 WP_001245277.1.87038 WP_001245277.1.87041 WP_001245277.1.87095 WP_001245277.1.87136 WP_001245277.1.87143 WP_001245277.1.87155 WP_001245277.1.87187 WP_001245277.1.87219 WP_001245277.1.8722 WP_001245277.1.87258 WP_001245277.1.87265 WP_001245277.1.87282 WP_001245277.1.87283 WP_001245277.1.87293 WP_001245277.1.87323 WP_001245277.1.87346 WP_001245277.1.8736 WP_001245277.1.87365 WP_001245277.1.87370 WP_001245277.1.87376 WP_001245277.1.87420 WP_001245277.1.87460 WP_001245277.1.87484 WP_001245277.1.87493 WP_001245277.1.87500 WP_001245277.1.87528 WP_001245277.1.87552 WP_001245277.1.87560 WP_001245277.1.87583 WP_001245277.1.8760 WP_001245277.1.87600 WP_001245277.1.87609 WP_001245277.1.87612 WP_001245277.1.87615 WP_001245277.1.87618 WP_001245277.1.87626 WP_001245277.1.87651 WP_001245277.1.87653 WP_001245277.1.87659 WP_001245277.1.87687 WP_001245277.1.87695 WP_001245277.1.87698 WP_001245277.1.87706 WP_001245277.1.87712 WP_001245277.1.87739 WP_001245277.1.87741 WP_001245277.1.87742 WP_001245277.1.87760 WP_001245277.1.87779 WP_001245277.1.87852 WP_001245277.1.87875 WP_001245277.1.87891 WP_001245277.1.87899 WP_001245277.1.87905 WP_001245277.1.8792 WP_001245277.1.87933 WP_001245277.1.87936 WP_001245277.1.87945 WP_001245277.1.87949 WP_001245277.1.87999 WP_001245277.1.88019 WP_001245277.1.88025 WP_001245277.1.88026 WP_001245277.1.8805 WP_001245277.1.88052 WP_001245277.1.8806 WP_001245277.1.88073 WP_001245277.1.8809 WP_001245277.1.88092 WP_001245277.1.881 WP_001245277.1.88136 WP_001245277.1.88145 WP_001245277.1.88165 WP_001245277.1.88174 WP_001245277.1.88185 WP_001245277.1.88199 WP_001245277.1.88214 WP_001245277.1.88222 WP_001245277.1.88244 WP_001245277.1.88275 WP_001245277.1.88291 WP_001245277.1.88293 WP_001245277.1.88299 WP_001245277.1.88303 WP_001245277.1.88313 WP_001245277.1.88356 WP_001245277.1.88359 WP_001245277.1.8837 WP_001245277.1.88393 WP_001245277.1.88407 WP_001245277.1.88414 WP_001245277.1.88423 WP_001245277.1.88444 WP_001245277.1.88446 WP_001245277.1.88458 WP_001245277.1.88474 WP_001245277.1.8849 WP_001245277.1.88501 WP_001245277.1.88508 WP_001245277.1.88538 WP_001245277.1.88547 WP_001245277.1.886 WP_001245277.1.88609 WP_001245277.1.88624 WP_001245277.1.88647 WP_001245277.1.88648 WP_001245277.1.88675 WP_001245277.1.88683 WP_001245277.1.88692 WP_001245277.1.88698 WP_001245277.1.88703 WP_001245277.1.88707 WP_001245277.1.88727 WP_001245277.1.88731 WP_001245277.1.88762 WP_001245277.1.88772 WP_001245277.1.88776 WP_001245277.1.88792 WP_001245277.1.88817 WP_001245277.1.88845 WP_001245277.1.88850 WP_001245277.1.88854 WP_001245277.1.8889 WP_001245277.1.88892 WP_001245277.1.88894 WP_001245277.1.88902 WP_001245277.1.8891 WP_001245277.1.88942 WP_001245277.1.88957 WP_001245277.1.88966 WP_001245277.1.88968 WP_001245277.1.88970 WP_001245277.1.88980 WP_001245277.1.88981 WP_001245277.1.88982 WP_001245277.1.88995 WP_001245277.1.88998 WP_001245277.1.89008 WP_001245277.1.89054 WP_001245277.1.89114 WP_001245277.1.89116 WP_001245277.1.89119 WP_001245277.1.89120 WP_001245277.1.89138 WP_001245277.1.89169 WP_001245277.1.89177 WP_001245277.1.89182 WP_001245277.1.89188 WP_001245277.1.89215 WP_001245277.1.89221 WP_001245277.1.89291 WP_001245277.1.89298 WP_001245277.1.89304 WP_001245277.1.89308 WP_001245277.1.89311 WP_001245277.1.89314 WP_001245277.1.89328 WP_001245277.1.89332 WP_001245277.1.89343 WP_001245277.1.89354 WP_001245277.1.89355 WP_001245277.1.89362 WP_001245277.1.89395 WP_001245277.1.8940 WP_001245277.1.89408 WP_001245277.1.89425 WP_001245277.1.89449 WP_001245277.1.89452 WP_001245277.1.89462 WP_001245277.1.8947 WP_001245277.1.89503 WP_001245277.1.89512 WP_001245277.1.89527 WP_001245277.1.89570 WP_001245277.1.8958 WP_001245277.1.89580 WP_001245277.1.89591 WP_001245277.1.89604 WP_001245277.1.89606 WP_001245277.1.8961 WP_001245277.1.89612 WP_001245277.1.89622 WP_001245277.1.89632 WP_001245277.1.89634 WP_001245277.1.89657 WP_001245277.1.89659 WP_001245277.1.89668 WP_001245277.1.89680 WP_001245277.1.89706 WP_001245277.1.89713 WP_001245277.1.89733 WP_001245277.1.89765 WP_001245277.1.89789 WP_001245277.1.89796 WP_001245277.1.89804 WP_001245277.1.89815 WP_001245277.1.89817 WP_001245277.1.89832 WP_001245277.1.89845 WP_001245277.1.89870 WP_001245277.1.89888 WP_001245277.1.89902 WP_001245277.1.89911 WP_001245277.1.89914 WP_001245277.1.89940 WP_001245277.1.8995 WP_001245277.1.89952 WP_001245277.1.8996 WP_001245277.1.89965 WP_001245277.1.89975 WP_001245277.1.90007 WP_001245277.1.9002 WP_001245277.1.9003 WP_001245277.1.90033 WP_001245277.1.90084 WP_001245277.1.90097 WP_001245277.1.90108 WP_001245277.1.9011 WP_001245277.1.90196 WP_001245277.1.90211 WP_001245277.1.90240 WP_001245277.1.90248 WP_001245277.1.90252 WP_001245277.1.90274 WP_001245277.1.90280 WP_001245277.1.90293 WP_001245277.1.90311 WP_001245277.1.90330 WP_001245277.1.90338 WP_001245277.1.90348 WP_001245277.1.90363 WP_001245277.1.90365 WP_001245277.1.90409 WP_001245277.1.90417 WP_001245277.1.90421 WP_001245277.1.90428 WP_001245277.1.90453 WP_001245277.1.90458 WP_001245277.1.90472 WP_001245277.1.90489 WP_001245277.1.90513 WP_001245277.1.90522 WP_001245277.1.90540 WP_001245277.1.90557 WP_001245277.1.90563 WP_001245277.1.90566 WP_001245277.1.90582 WP_001245277.1.90585 WP_001245277.1.90620 WP_001245277.1.90625 WP_001245277.1.90641 WP_001245277.1.90686 WP_001245277.1.90701 WP_001245277.1.90713 WP_001245277.1.90734 WP_001245277.1.90748 WP_001245277.1.90759 WP_001245277.1.90794 WP_001245277.1.90796 WP_001245277.1.90811 WP_001245277.1.90814 WP_001245277.1.90859 WP_001245277.1.90866 WP_001245277.1.90878 WP_001245277.1.9091 WP_001245277.1.9093 WP_001245277.1.90959 WP_001245277.1.90973 WP_001245277.1.90983 WP_001245277.1.90984 WP_001245277.1.90991 WP_001245277.1.91003 WP_001245277.1.91042 WP_001245277.1.91049 WP_001245277.1.91056 WP_001245277.1.91067 WP_001245277.1.91069 WP_001245277.1.91107 WP_001245277.1.91156 WP_001245277.1.91164 WP_001245277.1.91179 WP_001245277.1.91189 WP_001245277.1.91205 WP_001245277.1.91215 WP_001245277.1.91239 WP_001245277.1.91278 WP_001245277.1.91282 WP_001245277.1.91291 WP_001245277.1.9131 WP_001245277.1.91312 WP_001245277.1.91313 WP_001245277.1.91331 WP_001245277.1.9135 WP_001245277.1.9137 WP_001245277.1.91372 WP_001245277.1.91405 WP_001245277.1.91424 WP_001245277.1.91453 WP_001245277.1.91459 WP_001245277.1.91470 WP_001245277.1.91474 WP_001245277.1.91493 WP_001245277.1.91505 WP_001245277.1.91506 WP_001245277.1.91512 WP_001245277.1.91524 WP_001245277.1.91528 WP_001245277.1.91557 WP_001245277.1.91564 WP_001245277.1.91579 WP_001245277.1.91597 WP_001245277.1.91621 WP_001245277.1.91625 WP_001245277.1.91628 WP_001245277.1.91655 WP_001245277.1.9166 WP_001245277.1.91702 WP_001245277.1.91715 WP_001245277.1.91724 WP_001245277.1.91732 WP_001245277.1.91736 WP_001245277.1.91742 WP_001245277.1.91772 WP_001245277.1.91776 WP_001245277.1.91788 WP_001245277.1.91795 WP_001245277.1.91806 WP_001245277.1.9187 WP_001245277.1.91870 WP_001245277.1.91898 WP_001245277.1.91903 WP_001245277.1.91904 WP_001245277.1.91974 WP_001245277.1.91984 WP_001245277.1.92013 WP_001245277.1.92018 WP_001245277.1.92044 WP_001245277.1.92047 WP_001245277.1.92060 WP_001245277.1.92068 WP_001245277.1.92082 WP_001245277.1.92087 WP_001245277.1.92093 WP_001245277.1.92098 WP_001245277.1.92099 WP_001245277.1.92108 WP_001245277.1.92122 WP_001245277.1.92129 WP_001245277.1.92156 WP_001245277.1.92165 WP_001245277.1.92171 WP_001245277.1.92172 WP_001245277.1.92183 WP_001245277.1.92208 WP_001245277.1.92213 WP_001245277.1.9222 WP_001245277.1.92240 WP_001245277.1.92243 WP_001245277.1.92268 WP_001245277.1.92270 WP_001245277.1.92299 WP_001245277.1.92310 WP_001245277.1.92318 WP_001245277.1.92327 WP_001245277.1.92375 WP_001245277.1.92394 WP_001245277.1.92408 WP_001245277.1.92411 WP_001245277.1.92439 WP_001245277.1.92443 WP_001245277.1.92452 WP_001245277.1.92470 WP_001245277.1.92477 WP_001245277.1.92482 WP_001245277.1.92531 WP_001245277.1.92545 WP_001245277.1.92557 WP_001245277.1.92562 WP_001245277.1.92570 WP_001245277.1.92575 WP_001245277.1.92588 WP_001245277.1.926 WP_001245277.1.92628 WP_001245277.1.92633 WP_001245277.1.92646 WP_001245277.1.92649 WP_001245277.1.92659 WP_001245277.1.92669 WP_001245277.1.92671 WP_001245277.1.92676 WP_001245277.1.92705 WP_001245277.1.9271 WP_001245277.1.92729 WP_001245277.1.92734 WP_001245277.1.92738 WP_001245277.1.92754 WP_001245277.1.92758 WP_001245277.1.92786 WP_001245277.1.92806 WP_001245277.1.92810 WP_001245277.1.92823 WP_001245277.1.92827 WP_001245277.1.92832 WP_001245277.1.92836 WP_001245277.1.92842 WP_001245277.1.92843 WP_001245277.1.92875 WP_001245277.1.92879 WP_001245277.1.92890 WP_001245277.1.92893 WP_001245277.1.92895 WP_001245277.1.92926 WP_001245277.1.92929 WP_001245277.1.92936 WP_001245277.1.92939 WP_001245277.1.92947 WP_001245277.1.92975 WP_001245277.1.92987 WP_001245277.1.92988 WP_001245277.1.93007 WP_001245277.1.93022 WP_001245277.1.93059 WP_001245277.1.93076 WP_001245277.1.93086 WP_001245277.1.93101 WP_001245277.1.93103 WP_001245277.1.93105 WP_001245277.1.93111 WP_001245277.1.93121 WP_001245277.1.93136 WP_001245277.1.93155 WP_001245277.1.93168 WP_001245277.1.93184 WP_001245277.1.93213 WP_001245277.1.93215 WP_001245277.1.93221 WP_001245277.1.93223 WP_001245277.1.93239 WP_001245277.1.93275 WP_001245277.1.93302 WP_001245277.1.93339 WP_001245277.1.93350 WP_001245277.1.9336 WP_001245277.1.93365 WP_001245277.1.93376 WP_001245277.1.93387 WP_001245277.1.93410 WP_001245277.1.93469 WP_001245277.1.93511 WP_001245277.1.93512 WP_001245277.1.93524 WP_001245277.1.93543 WP_001245277.1.93577 WP_001245277.1.93596 WP_001245277.1.93635 WP_001245277.1.93648 WP_001245277.1.93650 WP_001245277.1.93656 WP_001245277.1.93657 WP_001245277.1.93662 WP_001245277.1.93691 WP_001245277.1.937 WP_001245277.1.93705 WP_001245277.1.9374 WP_001245277.1.9375 WP_001245277.1.93754 WP_001245277.1.93761 WP_001245277.1.93767 WP_001245277.1.93780 WP_001245277.1.9380 WP_001245277.1.93803 WP_001245277.1.93804 WP_001245277.1.93809 WP_001245277.1.93828 WP_001245277.1.93842 WP_001245277.1.93843 WP_001245277.1.93875 WP_001245277.1.9389 WP_001245277.1.93909 WP_001245277.1.93919 WP_001245277.1.93937 WP_001245277.1.93938 WP_001245277.1.93956 WP_001245277.1.93984 WP_001245277.1.9399 WP_001245277.1.93994 WP_001245277.1.94017 WP_001245277.1.94039 WP_001245277.1.94056 WP_001245277.1.94064 WP_001245277.1.94072 WP_001245277.1.94079 WP_001245277.1.94097 WP_001245277.1.94107 WP_001245277.1.94132 WP_001245277.1.94142 WP_001245277.1.94162 WP_001245277.1.94168 WP_001245277.1.94198 WP_001245277.1.94215 WP_001245277.1.94303 WP_001245277.1.9432 WP_001245277.1.94352 WP_001245277.1.94354 WP_001245277.1.94365 WP_001245277.1.94379 WP_001245277.1.94380 WP_001245277.1.94390 WP_001245277.1.9440 WP_001245277.1.94415 WP_001245277.1.94458 WP_001245277.1.94473 WP_001245277.1.94492 WP_001245277.1.94510 WP_001245277.1.94527 WP_001245277.1.94562 WP_001245277.1.94565 WP_001245277.1.94573 WP_001245277.1.94579 WP_001245277.1.94584 WP_001245277.1.94586 WP_001245277.1.94593 WP_001245277.1.94598 WP_001245277.1.94622 WP_001245277.1.9463 WP_001245277.1.94649 WP_001245277.1.94650 WP_001245277.1.94655 WP_001245277.1.94659 WP_001245277.1.94662 WP_001245277.1.94670 WP_001245277.1.94674 WP_001245277.1.94700 WP_001245277.1.94717 WP_001245277.1.94722 WP_001245277.1.94745 WP_001245277.1.94782 WP_001245277.1.94796 WP_001245277.1.94798 WP_001245277.1.9481 WP_001245277.1.94815 WP_001245277.1.94817 WP_001245277.1.94820 WP_001245277.1.94835 WP_001245277.1.94849 WP_001245277.1.94850 WP_001245277.1.94851 WP_001245277.1.94862 WP_001245277.1.94864 WP_001245277.1.94921 WP_001245277.1.94947 WP_001245277.1.94952 WP_001245277.1.94959 WP_001245277.1.94982 WP_001245277.1.94983 WP_001245277.1.94987 WP_001245277.1.95006 WP_001245277.1.9503 WP_001245277.1.95051 WP_001245277.1.95055 WP_001245277.1.95076 WP_001245277.1.95085 WP_001245277.1.95099 WP_001245277.1.95121 WP_001245277.1.95133 WP_001245277.1.95136 WP_001245277.1.95152 WP_001245277.1.9516 WP_001245277.1.95165 WP_001245277.1.95171 WP_001245277.1.95235 WP_001245277.1.95239 WP_001245277.1.95246 WP_001245277.1.95248 WP_001245277.1.9525 WP_001245277.1.95255 WP_001245277.1.95265 WP_001245277.1.9527 WP_001245277.1.95277 WP_001245277.1.95282 WP_001245277.1.95289 WP_001245277.1.95298 WP_001245277.1.9530 WP_001245277.1.95338 WP_001245277.1.95388 WP_001245277.1.95404 WP_001245277.1.95412 WP_001245277.1.95434 WP_001245277.1.95447 WP_001245277.1.95456 WP_001245277.1.95530 WP_001245277.1.95547 WP_001245277.1.95558 WP_001245277.1.95579 WP_001245277.1.95590 WP_001245277.1.95607 WP_001245277.1.95623 WP_001245277.1.95625 WP_001245277.1.95630 WP_001245277.1.95641 WP_001245277.1.95656 WP_001245277.1.95670 WP_001245277.1.95675 WP_001245277.1.95691 WP_001245277.1.95701 WP_001245277.1.95703 WP_001245277.1.95716 WP_001245277.1.95729 WP_001245277.1.9574 WP_001245277.1.95757 WP_001245277.1.95776 WP_001245277.1.95803 WP_001245277.1.95826 WP_001245277.1.9586 WP_001245277.1.95866 WP_001245277.1.95884 WP_001245277.1.95890 WP_001245277.1.95906 WP_001245277.1.95911 WP_001245277.1.95939 WP_001245277.1.95940 WP_001245277.1.95963 WP_001245277.1.96004 WP_001245277.1.96025 WP_001245277.1.96042 WP_001245277.1.96044 WP_001245277.1.96054 WP_001245277.1.96094 WP_001245277.1.96107 WP_001245277.1.96127 WP_001245277.1.96139 WP_001245277.1.96141 WP_001245277.1.96144 WP_001245277.1.96162 WP_001245277.1.96172 WP_001245277.1.96188 WP_001245277.1.96190 WP_001245277.1.96203 WP_001245277.1.96206 WP_001245277.1.96211 WP_001245277.1.96212 WP_001245277.1.9624 WP_001245277.1.96260 WP_001245277.1.9628 WP_001245277.1.96317 WP_001245277.1.96319 WP_001245277.1.9633 WP_001245277.1.96335 WP_001245277.1.96340 WP_001245277.1.96343 WP_001245277.1.96348 WP_001245277.1.96349 WP_001245277.1.96359 WP_001245277.1.96380 WP_001245277.1.96404 WP_001245277.1.96429 WP_001245277.1.9644 WP_001245277.1.96469 WP_001245277.1.96490 WP_001245277.1.96497 WP_001245277.1.96500 WP_001245277.1.96521 WP_001245277.1.96537 WP_001245277.1.96539 WP_001245277.1.96552 WP_001245277.1.96555 WP_001245277.1.96563 WP_001245277.1.96584 WP_001245277.1.96588 WP_001245277.1.96590 WP_001245277.1.96610 WP_001245277.1.96625 WP_001245277.1.96635 WP_001245277.1.9664 WP_001245277.1.96642 WP_001245277.1.96662 WP_001245277.1.96675 WP_001245277.1.9670 WP_001245277.1.96721 WP_001245277.1.96731 WP_001245277.1.96732 WP_001245277.1.96735 WP_001245277.1.9674 WP_001245277.1.96750 WP_001245277.1.96758 WP_001245277.1.96761 WP_001245277.1.96771 WP_001245277.1.96792 WP_001245277.1.96798 WP_001245277.1.96801 WP_001245277.1.96803 WP_001245277.1.96810 WP_001245277.1.9686 WP_001245277.1.96876 WP_001245277.1.96890 WP_001245277.1.96917 WP_001245277.1.96925 WP_001245277.1.96938 WP_001245277.1.96946 WP_001245277.1.96957 WP_001245277.1.96978 WP_001245277.1.96993 WP_001245277.1.97015 WP_001245277.1.97026 WP_001245277.1.97028 WP_001245277.1.97043 WP_001245277.1.97047 WP_001245277.1.97079 WP_001245277.1.97089 WP_001245277.1.97103 WP_001245277.1.97109 WP_001245277.1.97143 WP_001245277.1.97145 WP_001245277.1.97154 WP_001245277.1.97184 WP_001245277.1.97185 WP_001245277.1.97190 WP_001245277.1.97260 WP_001245277.1.97287 WP_001245277.1.97291 WP_001245277.1.97297 WP_001245277.1.97318 WP_001245277.1.97322 WP_001245277.1.97328 WP_001245277.1.97337 WP_001245277.1.97368 WP_001245277.1.97369 WP_001245277.1.97386 WP_001245277.1.97413 WP_001245277.1.97422 WP_001245277.1.97441 WP_001245277.1.97477 WP_001245277.1.97480 WP_001245277.1.97487 WP_001245277.1.97497 WP_001245277.1.97505 WP_001245277.1.97534 WP_001245277.1.97547 WP_001245277.1.97594 WP_001245277.1.97597 WP_001245277.1.97599 WP_001245277.1.97606 WP_001245277.1.97613 WP_001245277.1.97615 WP_001245277.1.97620 WP_001245277.1.97631 WP_001245277.1.97640 WP_001245277.1.97646 WP_001245277.1.97648 WP_001245277.1.97656 WP_001245277.1.97690 WP_001245277.1.97704 WP_001245277.1.97725 WP_001245277.1.97726 WP_001245277.1.97727 WP_001245277.1.97732 WP_001245277.1.97736 WP_001245277.1.9774 WP_001245277.1.9775 WP_001245277.1.97772 WP_001245277.1.97800 WP_001245277.1.97819 WP_001245277.1.97840 WP_001245277.1.97846 WP_001245277.1.97873 WP_001245277.1.97907 WP_001245277.1.9793 WP_001245277.1.97938 WP_001245277.1.97981 WP_001245277.1.97983 WP_001245277.1.97986 WP_001245277.1.9799 WP_001245277.1.97991 WP_001245277.1.98006 WP_001245277.1.98019 WP_001245277.1.98022 WP_001245277.1.98036 WP_001245277.1.9805 WP_001245277.1.98080 WP_001245277.1.98086 WP_001245277.1.98107 WP_001245277.1.98110 WP_001245277.1.98119 WP_001245277.1.98124 WP_001245277.1.98146 WP_001245277.1.98158 WP_001245277.1.98170 WP_001245277.1.98219 WP_001245277.1.98236 WP_001245277.1.98250 WP_001245277.1.9826 WP_001245277.1.98263 WP_001245277.1.98314 WP_001245277.1.98338 WP_001245277.1.98392 WP_001245277.1.98403 WP_001245277.1.9841 WP_001245277.1.98418 WP_001245277.1.98438 WP_001245277.1.98440 WP_001245277.1.98448 WP_001245277.1.98457 WP_001245277.1.98472 WP_001245277.1.98483 WP_001245277.1.98495 WP_001245277.1.9850 WP_001245277.1.98502 WP_001245277.1.98513 WP_001245277.1.98531 WP_001245277.1.98551 WP_001245277.1.98570 WP_001245277.1.98577 WP_001245277.1.98607 WP_001245277.1.98608 WP_001245277.1.98627 WP_001245277.1.9863 WP_001245277.1.98634 WP_001245277.1.98676 WP_001245277.1.98677 WP_001245277.1.98726 WP_001245277.1.98731 WP_001245277.1.98760 WP_001245277.1.98762 WP_001245277.1.98763 WP_001245277.1.98801 WP_001245277.1.98818 WP_001245277.1.98843 WP_001245277.1.9887 WP_001245277.1.98899 WP_001245277.1.98931 WP_001245277.1.98947 WP_001245277.1.9898 WP_001245277.1.9899 WP_001245277.1.99040 WP_001245277.1.99057 WP_001245277.1.99071 WP_001245277.1.99072 WP_001245277.1.99073 WP_001245277.1.99097 WP_001245277.1.99098 WP_001245277.1.99107 WP_001245277.1.99163 WP_001245277.1.99164 WP_001245277.1.99184 WP_001245277.1.9919 WP_001245277.1.99197 WP_001245277.1.99215 WP_001245277.1.99267 WP_001245277.1.99276 WP_001245277.1.99278 WP_001245277.1.99335 WP_001245277.1.99339 WP_001245277.1.99350 WP_001245277.1.99360 WP_001245277.1.99363 WP_001245277.1.99369 WP_001245277.1.99370 WP_001245277.1.99388 WP_001245277.1.99397 WP_001245277.1.99426 WP_001245277.1.99456 WP_001245277.1.99463 WP_001245277.1.99469 WP_001245277.1.99483 WP_001245277.1.99490 WP_001245277.1.99493 WP_001245277.1.99531 WP_001245277.1.9954 WP_001245277.1.99546 WP_001245277.1.99561 WP_001245277.1.99577 WP_001245277.1.99579 WP_001245277.1.99595 WP_001245277.1.99613 WP_001245277.1.99626 WP_001245277.1.99630 WP_001245277.1.99646 WP_001245277.1.99657 WP_001245277.1.99660 WP_001245277.1.99671 WP_001245277.1.99676 WP_001245277.1.99712 WP_001245277.1.99725 WP_001245277.1.99747 WP_001245277.1.99764 WP_001245277.1.99813 WP_001245277.1.99829 WP_001245277.1.99837 WP_001245277.1.99841 WP_001245277.1.99858 WP_001245277.1.99889 WP_001245277.1.9992 WP_001245277.1.99924 WP_001245277.1.99958 WP_001245277.1.99961 WP_001245277.1.99996 gi|409247257|ref|YP_006887956.1| gi|378957570|ref|YP_005215057.1| gi|62182079|ref|YP_218496.1| gi|194445874|ref|YP_002042825.1| gi|56415479|ref|YP_152554.1| gi|563654915|ref|YP_008863005.1| gi|378986174|ref|YP_005249330.1| gi|529221582|ref|YP_008383143.1| gi|488656380|ref|YP_007928183.1| gi|16766866|ref|NP_462481.1| gi|378446954|ref|YP_005234586.1| gi|198244215|ref|YP_002217539.1| gi|482906144|ref|YP_007904704.1| gi|207858818|ref|YP_002245469.1| gi|549726132|ref|YP_008646322.1| gi|550902923|ref|YP_008672015.1| gi|379702840|ref|YP_005244568.1| gi|378990884|ref|YP_005254048.1| gi|525859254|ref|YP_008262823.1| 209261.t3942 220341.STY4231 272994.SPAB_04445 295319.SPA3431 321314.SC3509 423368.SNSL254_A3849 439843.SeSA_A3772 439851.SeD_A3952 454166.SeAg_B3782 454169.SeHA_C3892 476213.SPC_3649 550537.SEN3403 550538.SG3857 99287.STM3580 gi|383498216|ref|YP_005398905.1| gi|525945773|ref|YP_008306764.1| ABAM02000001|CDS_4120114-4120671 ABAN01000001|CDS_316400-315843 ABAO01000004|CDS_105390-105947 ABEJ01000002|CDS_134423-134980 ABEL01000003|CDS_144154-144711 ABEW01000004|CDS_342727-342170 ABFF01000002|CDS_281827-281270 ABFH02000001|CDS_1430743-1430186 AE006468|CDS_3747662-3748219 AE014613|CDS_4082985-4082428 AE017220|CDS_3701776-3702333 AL513382|CDS_4098338-4097781 AM933172|CDS_3628514-3629071 AM933173|CDS_4069919-4069362 CP000026|CDS_3538488-3539045 CP000857|CDS_3680257-3680814 CP000886|CDS_3698992-3699549 CP001113|CDS_3722217-3722774 CP001120|CDS_3760764-3761321 CP001127|CDS_3631618-3632175 CP001138|CDS_3664933-3665490 CP001144|CDS_3787440-3787997 CP001363|CDS_3761360-3761917 FN424405|CDS_3770535-3771092 NZ_ACBF01000002|CDS_316881-316324 gi|378701470|ref|YP_005183428.1| gi|29144211|ref|NP_807553.1| gi|549480889|ref|YP_008615215.1| gi|224585372|ref|YP_002639171.1| gi|386593251|ref|YP_006089651.1| gi|16762724|ref|NP_458341.1| gi|537439138|ref|YP_008483515.1| gi|197247582|ref|YP_002148503.1| gi|194451348|ref|YP_002047605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]