SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198244260|ref|YP_002217200.1| from Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198244260|ref|YP_002217200.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.58e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.18e-40
Family N-terminal domain of adrenodoxin reductase-like 0.000000994
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198244260|ref|YP_002217200.1|
Sequence length 672
Comment FAD/FMN-binding/pyridine nucleotide-disulfide oxidoreductase family protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPIAPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLSQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGIRLALEI
Download sequence
Identical sequences A0A0G2NSU9 A0A2J0RTW7 A0A2K2LCD0 B5REH6 M7RPL8 S4IIZ5
439851.SeD_A3576 550537.SEN3061 550538.SG3115 gi|378956841|ref|YP_005214328.1| gi|205354133|ref|YP_002227934.1| WP_000121528.1.100017 WP_000121528.1.100077 WP_000121528.1.100149 WP_000121528.1.100191 WP_000121528.1.100392 WP_000121528.1.100412 WP_000121528.1.100457 WP_000121528.1.100519 WP_000121528.1.100541 WP_000121528.1.100557 WP_000121528.1.100605 WP_000121528.1.100776 WP_000121528.1.10081 WP_000121528.1.100857 WP_000121528.1.100895 WP_000121528.1.101112 WP_000121528.1.101541 WP_000121528.1.101634 WP_000121528.1.101674 WP_000121528.1.101832 WP_000121528.1.101917 WP_000121528.1.101927 WP_000121528.1.102111 WP_000121528.1.10300 WP_000121528.1.10498 WP_000121528.1.10631 WP_000121528.1.10755 WP_000121528.1.10868 WP_000121528.1.10898 WP_000121528.1.11119 WP_000121528.1.11216 WP_000121528.1.1150 WP_000121528.1.11526 WP_000121528.1.11528 WP_000121528.1.1156 WP_000121528.1.1169 WP_000121528.1.1174 WP_000121528.1.11824 WP_000121528.1.11841 WP_000121528.1.11900 WP_000121528.1.11978 WP_000121528.1.12027 WP_000121528.1.12106 WP_000121528.1.1215 WP_000121528.1.12168 WP_000121528.1.12340 WP_000121528.1.12374 WP_000121528.1.1239 WP_000121528.1.12485 WP_000121528.1.12568 WP_000121528.1.12569 WP_000121528.1.12696 WP_000121528.1.1300 WP_000121528.1.13076 WP_000121528.1.13102 WP_000121528.1.13247 WP_000121528.1.13274 WP_000121528.1.13367 WP_000121528.1.13391 WP_000121528.1.1346 WP_000121528.1.13573 WP_000121528.1.13625 WP_000121528.1.1412 WP_000121528.1.146 WP_000121528.1.14708 WP_000121528.1.14793 WP_000121528.1.14819 WP_000121528.1.14913 WP_000121528.1.15067 WP_000121528.1.15214 WP_000121528.1.15276 WP_000121528.1.15318 WP_000121528.1.15585 WP_000121528.1.1568 WP_000121528.1.15775 WP_000121528.1.15777 WP_000121528.1.16363 WP_000121528.1.16365 WP_000121528.1.16366 WP_000121528.1.16394 WP_000121528.1.16453 WP_000121528.1.16474 WP_000121528.1.16729 WP_000121528.1.16949 WP_000121528.1.16972 WP_000121528.1.17060 WP_000121528.1.17105 WP_000121528.1.1733 WP_000121528.1.17482 WP_000121528.1.17525 WP_000121528.1.17583 WP_000121528.1.17732 WP_000121528.1.17886 WP_000121528.1.17914 WP_000121528.1.17936 WP_000121528.1.18056 WP_000121528.1.18092 WP_000121528.1.18109 WP_000121528.1.18149 WP_000121528.1.18384 WP_000121528.1.18641 WP_000121528.1.18686 WP_000121528.1.18737 WP_000121528.1.18847 WP_000121528.1.18886 WP_000121528.1.1895 WP_000121528.1.19093 WP_000121528.1.19373 WP_000121528.1.19433 WP_000121528.1.1955 WP_000121528.1.19656 WP_000121528.1.19834 WP_000121528.1.19938 WP_000121528.1.20086 WP_000121528.1.20261 WP_000121528.1.2041 WP_000121528.1.20437 WP_000121528.1.2047 WP_000121528.1.20767 WP_000121528.1.2107 WP_000121528.1.21079 WP_000121528.1.21103 WP_000121528.1.2116 WP_000121528.1.21194 WP_000121528.1.21202 WP_000121528.1.21241 WP_000121528.1.21332 WP_000121528.1.21616 WP_000121528.1.21681 WP_000121528.1.21715 WP_000121528.1.21909 WP_000121528.1.21950 WP_000121528.1.22051 WP_000121528.1.22096 WP_000121528.1.22136 WP_000121528.1.22158 WP_000121528.1.22162 WP_000121528.1.22296 WP_000121528.1.22346 WP_000121528.1.22449 WP_000121528.1.22454 WP_000121528.1.22460 WP_000121528.1.22590 WP_000121528.1.22595 WP_000121528.1.22605 WP_000121528.1.22760 WP_000121528.1.22857 WP_000121528.1.22880 WP_000121528.1.22902 WP_000121528.1.22947 WP_000121528.1.2324 WP_000121528.1.23329 WP_000121528.1.23442 WP_000121528.1.2358 WP_000121528.1.23631 WP_000121528.1.24145 WP_000121528.1.24214 WP_000121528.1.24250 WP_000121528.1.24297 WP_000121528.1.24361 WP_000121528.1.24408 WP_000121528.1.24409 WP_000121528.1.24494 WP_000121528.1.24673 WP_000121528.1.24803 WP_000121528.1.24901 WP_000121528.1.24944 WP_000121528.1.25159 WP_000121528.1.25175 WP_000121528.1.25354 WP_000121528.1.25421 WP_000121528.1.25426 WP_000121528.1.25618 WP_000121528.1.2568 WP_000121528.1.25709 WP_000121528.1.25780 WP_000121528.1.25951 WP_000121528.1.26083 WP_000121528.1.26194 WP_000121528.1.26441 WP_000121528.1.26532 WP_000121528.1.26587 WP_000121528.1.26687 WP_000121528.1.2672 WP_000121528.1.26794 WP_000121528.1.26936 WP_000121528.1.27272 WP_000121528.1.27314 WP_000121528.1.27383 WP_000121528.1.27547 WP_000121528.1.27632 WP_000121528.1.27638 WP_000121528.1.27658 WP_000121528.1.27800 WP_000121528.1.27833 WP_000121528.1.27883 WP_000121528.1.27995 WP_000121528.1.28037 WP_000121528.1.28056 WP_000121528.1.28139 WP_000121528.1.28200 WP_000121528.1.28232 WP_000121528.1.28233 WP_000121528.1.28303 WP_000121528.1.28462 WP_000121528.1.2853 WP_000121528.1.28570 WP_000121528.1.28620 WP_000121528.1.28733 WP_000121528.1.28773 WP_000121528.1.29168 WP_000121528.1.29218 WP_000121528.1.2924 WP_000121528.1.29274 WP_000121528.1.2932 WP_000121528.1.29379 WP_000121528.1.29422 WP_000121528.1.29436 WP_000121528.1.29576 WP_000121528.1.29711 WP_000121528.1.3005 WP_000121528.1.30059 WP_000121528.1.30165 WP_000121528.1.30210 WP_000121528.1.30278 WP_000121528.1.30492 WP_000121528.1.30548 WP_000121528.1.30589 WP_000121528.1.30627 WP_000121528.1.3067 WP_000121528.1.30752 WP_000121528.1.30968 WP_000121528.1.31167 WP_000121528.1.31272 WP_000121528.1.31335 WP_000121528.1.31435 WP_000121528.1.31585 WP_000121528.1.3167 WP_000121528.1.31895 WP_000121528.1.31901 WP_000121528.1.31983 WP_000121528.1.32109 WP_000121528.1.32116 WP_000121528.1.32252 WP_000121528.1.32255 WP_000121528.1.32274 WP_000121528.1.32309 WP_000121528.1.32519 WP_000121528.1.32668 WP_000121528.1.32740 WP_000121528.1.32832 WP_000121528.1.32881 WP_000121528.1.32899 WP_000121528.1.32977 WP_000121528.1.33253 WP_000121528.1.33270 WP_000121528.1.33409 WP_000121528.1.335 WP_000121528.1.3356 WP_000121528.1.33586 WP_000121528.1.3364 WP_000121528.1.33865 WP_000121528.1.3396 WP_000121528.1.34091 WP_000121528.1.34185 WP_000121528.1.34292 WP_000121528.1.3438 WP_000121528.1.34431 WP_000121528.1.34454 WP_000121528.1.34614 WP_000121528.1.34684 WP_000121528.1.34711 WP_000121528.1.34820 WP_000121528.1.35298 WP_000121528.1.35321 WP_000121528.1.35332 WP_000121528.1.35563 WP_000121528.1.35570 WP_000121528.1.35594 WP_000121528.1.35619 WP_000121528.1.35624 WP_000121528.1.3572 WP_000121528.1.35887 WP_000121528.1.35936 WP_000121528.1.35961 WP_000121528.1.36037 WP_000121528.1.36063 WP_000121528.1.36409 WP_000121528.1.36445 WP_000121528.1.36584 WP_000121528.1.36685 WP_000121528.1.36721 WP_000121528.1.36764 WP_000121528.1.36889 WP_000121528.1.37029 WP_000121528.1.37114 WP_000121528.1.37191 WP_000121528.1.3726 WP_000121528.1.37297 WP_000121528.1.37405 WP_000121528.1.3748 WP_000121528.1.3771 WP_000121528.1.3778 WP_000121528.1.37864 WP_000121528.1.3790 WP_000121528.1.38037 WP_000121528.1.38047 WP_000121528.1.38344 WP_000121528.1.39048 WP_000121528.1.39055 WP_000121528.1.39065 WP_000121528.1.39312 WP_000121528.1.39395 WP_000121528.1.39614 WP_000121528.1.40081 WP_000121528.1.40158 WP_000121528.1.40284 WP_000121528.1.40307 WP_000121528.1.40493 WP_000121528.1.40533 WP_000121528.1.40577 WP_000121528.1.40622 WP_000121528.1.40695 WP_000121528.1.40745 WP_000121528.1.40849 WP_000121528.1.40930 WP_000121528.1.40973 WP_000121528.1.41116 WP_000121528.1.41128 WP_000121528.1.41192 WP_000121528.1.41277 WP_000121528.1.4141 WP_000121528.1.41427 WP_000121528.1.41434 WP_000121528.1.41528 WP_000121528.1.41610 WP_000121528.1.41688 WP_000121528.1.41690 WP_000121528.1.41799 WP_000121528.1.41802 WP_000121528.1.41911 WP_000121528.1.41949 WP_000121528.1.41978 WP_000121528.1.42136 WP_000121528.1.422 WP_000121528.1.42263 WP_000121528.1.42322 WP_000121528.1.42392 WP_000121528.1.42595 WP_000121528.1.42666 WP_000121528.1.42675 WP_000121528.1.42683 WP_000121528.1.42734 WP_000121528.1.42892 WP_000121528.1.43201 WP_000121528.1.4344 WP_000121528.1.43685 WP_000121528.1.43711 WP_000121528.1.43785 WP_000121528.1.44010 WP_000121528.1.44187 WP_000121528.1.44337 WP_000121528.1.44397 WP_000121528.1.44474 WP_000121528.1.44705 WP_000121528.1.44831 WP_000121528.1.44966 WP_000121528.1.44978 WP_000121528.1.44997 WP_000121528.1.4500 WP_000121528.1.45173 WP_000121528.1.45302 WP_000121528.1.4531 WP_000121528.1.45432 WP_000121528.1.45549 WP_000121528.1.45569 WP_000121528.1.45571 WP_000121528.1.45583 WP_000121528.1.45706 WP_000121528.1.45844 WP_000121528.1.45906 WP_000121528.1.45918 WP_000121528.1.4592 WP_000121528.1.46215 WP_000121528.1.46578 WP_000121528.1.46726 WP_000121528.1.4674 WP_000121528.1.4686 WP_000121528.1.46967 WP_000121528.1.46976 WP_000121528.1.47507 WP_000121528.1.47567 WP_000121528.1.47576 WP_000121528.1.4758 WP_000121528.1.47829 WP_000121528.1.47850 WP_000121528.1.47875 WP_000121528.1.47911 WP_000121528.1.4795 WP_000121528.1.47988 WP_000121528.1.48268 WP_000121528.1.4839 WP_000121528.1.48524 WP_000121528.1.48797 WP_000121528.1.49311 WP_000121528.1.49334 WP_000121528.1.49770 WP_000121528.1.50128 WP_000121528.1.50332 WP_000121528.1.50449 WP_000121528.1.50684 WP_000121528.1.50882 WP_000121528.1.50905 WP_000121528.1.50960 WP_000121528.1.51356 WP_000121528.1.51412 WP_000121528.1.51451 WP_000121528.1.51502 WP_000121528.1.51518 WP_000121528.1.51642 WP_000121528.1.51764 WP_000121528.1.51810 WP_000121528.1.51868 WP_000121528.1.51930 WP_000121528.1.51994 WP_000121528.1.520 WP_000121528.1.5211 WP_000121528.1.52301 WP_000121528.1.52321 WP_000121528.1.52582 WP_000121528.1.52586 WP_000121528.1.52833 WP_000121528.1.53107 WP_000121528.1.53119 WP_000121528.1.5313 WP_000121528.1.53198 WP_000121528.1.53234 WP_000121528.1.53362 WP_000121528.1.53385 WP_000121528.1.53567 WP_000121528.1.53664 WP_000121528.1.53778 WP_000121528.1.53781 WP_000121528.1.53896 WP_000121528.1.53961 WP_000121528.1.54068 WP_000121528.1.54283 WP_000121528.1.54366 WP_000121528.1.54469 WP_000121528.1.54615 WP_000121528.1.54833 WP_000121528.1.54877 WP_000121528.1.54936 WP_000121528.1.55559 WP_000121528.1.55640 WP_000121528.1.5572 WP_000121528.1.5577 WP_000121528.1.55853 WP_000121528.1.55923 WP_000121528.1.55948 WP_000121528.1.56235 WP_000121528.1.56263 WP_000121528.1.5668 WP_000121528.1.56851 WP_000121528.1.56861 WP_000121528.1.56898 WP_000121528.1.56950 WP_000121528.1.57026 WP_000121528.1.57039 WP_000121528.1.57056 WP_000121528.1.5711 WP_000121528.1.57143 WP_000121528.1.57246 WP_000121528.1.57296 WP_000121528.1.57362 WP_000121528.1.57631 WP_000121528.1.57835 WP_000121528.1.57893 WP_000121528.1.58090 WP_000121528.1.5828 WP_000121528.1.58290 WP_000121528.1.58443 WP_000121528.1.58486 WP_000121528.1.58489 WP_000121528.1.58675 WP_000121528.1.587 WP_000121528.1.58749 WP_000121528.1.58884 WP_000121528.1.58926 WP_000121528.1.59142 WP_000121528.1.59163 WP_000121528.1.59335 WP_000121528.1.59427 WP_000121528.1.59538 WP_000121528.1.59548 WP_000121528.1.59646 WP_000121528.1.59848 WP_000121528.1.60126 WP_000121528.1.60137 WP_000121528.1.60320 WP_000121528.1.6033 WP_000121528.1.60425 WP_000121528.1.60560 WP_000121528.1.60713 WP_000121528.1.608 WP_000121528.1.60866 WP_000121528.1.60897 WP_000121528.1.61356 WP_000121528.1.61381 WP_000121528.1.61501 WP_000121528.1.61594 WP_000121528.1.61595 WP_000121528.1.61671 WP_000121528.1.61908 WP_000121528.1.62158 WP_000121528.1.62201 WP_000121528.1.62210 WP_000121528.1.62245 WP_000121528.1.62412 WP_000121528.1.627 WP_000121528.1.62745 WP_000121528.1.62757 WP_000121528.1.6292 WP_000121528.1.62983 WP_000121528.1.62988 WP_000121528.1.63045 WP_000121528.1.63102 WP_000121528.1.63229 WP_000121528.1.63358 WP_000121528.1.63497 WP_000121528.1.63509 WP_000121528.1.63529 WP_000121528.1.63585 WP_000121528.1.63603 WP_000121528.1.6370 WP_000121528.1.63748 WP_000121528.1.63851 WP_000121528.1.63863 WP_000121528.1.64010 WP_000121528.1.64085 WP_000121528.1.64109 WP_000121528.1.64121 WP_000121528.1.64157 WP_000121528.1.64229 WP_000121528.1.64350 WP_000121528.1.64385 WP_000121528.1.64462 WP_000121528.1.64500 WP_000121528.1.64597 WP_000121528.1.64711 WP_000121528.1.65011 WP_000121528.1.65357 WP_000121528.1.65601 WP_000121528.1.65698 WP_000121528.1.65771 WP_000121528.1.65881 WP_000121528.1.65883 WP_000121528.1.65901 WP_000121528.1.6595 WP_000121528.1.66122 WP_000121528.1.66171 WP_000121528.1.66289 WP_000121528.1.66315 WP_000121528.1.66385 WP_000121528.1.66400 WP_000121528.1.66428 WP_000121528.1.66446 WP_000121528.1.66539 WP_000121528.1.66733 WP_000121528.1.66937 WP_000121528.1.66959 WP_000121528.1.67075 WP_000121528.1.6710 WP_000121528.1.67173 WP_000121528.1.67279 WP_000121528.1.6760 WP_000121528.1.6782 WP_000121528.1.67932 WP_000121528.1.68140 WP_000121528.1.68159 WP_000121528.1.68652 WP_000121528.1.68677 WP_000121528.1.68893 WP_000121528.1.68895 WP_000121528.1.69080 WP_000121528.1.69086 WP_000121528.1.69131 WP_000121528.1.69236 WP_000121528.1.69273 WP_000121528.1.69357 WP_000121528.1.69485 WP_000121528.1.69575 WP_000121528.1.69616 WP_000121528.1.69767 WP_000121528.1.69965 WP_000121528.1.70088 WP_000121528.1.70272 WP_000121528.1.70303 WP_000121528.1.70440 WP_000121528.1.70531 WP_000121528.1.70596 WP_000121528.1.70678 WP_000121528.1.70785 WP_000121528.1.70837 WP_000121528.1.70929 WP_000121528.1.70977 WP_000121528.1.70985 WP_000121528.1.71172 WP_000121528.1.71184 WP_000121528.1.71201 WP_000121528.1.71305 WP_000121528.1.71600 WP_000121528.1.71626 WP_000121528.1.71649 WP_000121528.1.71979 WP_000121528.1.71984 WP_000121528.1.720 WP_000121528.1.72100 WP_000121528.1.72182 WP_000121528.1.72190 WP_000121528.1.72221 WP_000121528.1.72300 WP_000121528.1.72325 WP_000121528.1.72339 WP_000121528.1.72470 WP_000121528.1.72532 WP_000121528.1.72602 WP_000121528.1.72625 WP_000121528.1.72716 WP_000121528.1.72718 WP_000121528.1.72865 WP_000121528.1.7295 WP_000121528.1.73068 WP_000121528.1.73708 WP_000121528.1.73764 WP_000121528.1.74174 WP_000121528.1.74207 WP_000121528.1.74248 WP_000121528.1.743 WP_000121528.1.74300 WP_000121528.1.74578 WP_000121528.1.74972 WP_000121528.1.75051 WP_000121528.1.75056 WP_000121528.1.75148 WP_000121528.1.75159 WP_000121528.1.75400 WP_000121528.1.75450 WP_000121528.1.7558 WP_000121528.1.75607 WP_000121528.1.75716 WP_000121528.1.75751 WP_000121528.1.75794 WP_000121528.1.75810 WP_000121528.1.75863 WP_000121528.1.75902 WP_000121528.1.76108 WP_000121528.1.76137 WP_000121528.1.76345 WP_000121528.1.76451 WP_000121528.1.76495 WP_000121528.1.76776 WP_000121528.1.76913 WP_000121528.1.76968 WP_000121528.1.77067 WP_000121528.1.77306 WP_000121528.1.77356 WP_000121528.1.77475 WP_000121528.1.77496 WP_000121528.1.7792 WP_000121528.1.7793 WP_000121528.1.77951 WP_000121528.1.77983 WP_000121528.1.77989 WP_000121528.1.7802 WP_000121528.1.78051 WP_000121528.1.78443 WP_000121528.1.78501 WP_000121528.1.78603 WP_000121528.1.78632 WP_000121528.1.78658 WP_000121528.1.78697 WP_000121528.1.78734 WP_000121528.1.7877 WP_000121528.1.78815 WP_000121528.1.78877 WP_000121528.1.78896 WP_000121528.1.79099 WP_000121528.1.79289 WP_000121528.1.79468 WP_000121528.1.79580 WP_000121528.1.79586 WP_000121528.1.79757 WP_000121528.1.7982 WP_000121528.1.7991 WP_000121528.1.80249 WP_000121528.1.80254 WP_000121528.1.80380 WP_000121528.1.80609 WP_000121528.1.80760 WP_000121528.1.80874 WP_000121528.1.80876 WP_000121528.1.8106 WP_000121528.1.81109 WP_000121528.1.81110 WP_000121528.1.81197 WP_000121528.1.81225 WP_000121528.1.8130 WP_000121528.1.8134 WP_000121528.1.81388 WP_000121528.1.81455 WP_000121528.1.81668 WP_000121528.1.81768 WP_000121528.1.82401 WP_000121528.1.82420 WP_000121528.1.82434 WP_000121528.1.8247 WP_000121528.1.82474 WP_000121528.1.82569 WP_000121528.1.83005 WP_000121528.1.83006 WP_000121528.1.83204 WP_000121528.1.83354 WP_000121528.1.83356 WP_000121528.1.83558 WP_000121528.1.8399 WP_000121528.1.84000 WP_000121528.1.84011 WP_000121528.1.84075 WP_000121528.1.84086 WP_000121528.1.84154 WP_000121528.1.8425 WP_000121528.1.84300 WP_000121528.1.84497 WP_000121528.1.84515 WP_000121528.1.84572 WP_000121528.1.84598 WP_000121528.1.84876 WP_000121528.1.84983 WP_000121528.1.85079 WP_000121528.1.8526 WP_000121528.1.85271 WP_000121528.1.85301 WP_000121528.1.85759 WP_000121528.1.85982 WP_000121528.1.86138 WP_000121528.1.86157 WP_000121528.1.86159 WP_000121528.1.8616 WP_000121528.1.86240 WP_000121528.1.86347 WP_000121528.1.86380 WP_000121528.1.8647 WP_000121528.1.86514 WP_000121528.1.86610 WP_000121528.1.86915 WP_000121528.1.87038 WP_000121528.1.87187 WP_000121528.1.87265 WP_000121528.1.87484 WP_000121528.1.87500 WP_000121528.1.87583 WP_000121528.1.87712 WP_000121528.1.87760 WP_000121528.1.87905 WP_000121528.1.87936 WP_000121528.1.88052 WP_000121528.1.88185 WP_000121528.1.88275 WP_000121528.1.88356 WP_000121528.1.88474 WP_000121528.1.88508 WP_000121528.1.88731 WP_000121528.1.88854 WP_000121528.1.88966 WP_000121528.1.88968 WP_000121528.1.88982 WP_000121528.1.88998 WP_000121528.1.89120 WP_000121528.1.89177 WP_000121528.1.89221 WP_000121528.1.89362 WP_000121528.1.89408 WP_000121528.1.89425 WP_000121528.1.89606 WP_000121528.1.8961 WP_000121528.1.89634 WP_000121528.1.89680 WP_000121528.1.89832 WP_000121528.1.9003 WP_000121528.1.90421 WP_000121528.1.90522 WP_000121528.1.90540 WP_000121528.1.90563 WP_000121528.1.90748 WP_000121528.1.90759 WP_000121528.1.90859 WP_000121528.1.90959 WP_000121528.1.90973 WP_000121528.1.90983 WP_000121528.1.91215 WP_000121528.1.9137 WP_000121528.1.91372 WP_000121528.1.91424 WP_000121528.1.91474 WP_000121528.1.91505 WP_000121528.1.91742 WP_000121528.1.91772 WP_000121528.1.91776 WP_000121528.1.91795 WP_000121528.1.91898 WP_000121528.1.91904 WP_000121528.1.91974 WP_000121528.1.92082 WP_000121528.1.92129 WP_000121528.1.9222 WP_000121528.1.92452 WP_000121528.1.92557 WP_000121528.1.92628 WP_000121528.1.92754 WP_000121528.1.92806 WP_000121528.1.92890 WP_000121528.1.92929 WP_000121528.1.93076 WP_000121528.1.93215 WP_000121528.1.93350 WP_000121528.1.93410 WP_000121528.1.93524 WP_000121528.1.93577 WP_000121528.1.9380 WP_000121528.1.93809 WP_000121528.1.9440 WP_000121528.1.94473 WP_000121528.1.94598 WP_000121528.1.94649 WP_000121528.1.94670 WP_000121528.1.94835 WP_000121528.1.94983 WP_000121528.1.95136 WP_000121528.1.9527 WP_000121528.1.95434 WP_000121528.1.95447 WP_000121528.1.95456 WP_000121528.1.95558 WP_000121528.1.95607 WP_000121528.1.95656 WP_000121528.1.95757 WP_000121528.1.9586 WP_000121528.1.95866 WP_000121528.1.95963 WP_000121528.1.96107 WP_000121528.1.9624 WP_000121528.1.96340 WP_000121528.1.96348 WP_000121528.1.96349 WP_000121528.1.96380 WP_000121528.1.96490 WP_000121528.1.96521 WP_000121528.1.96537 WP_000121528.1.96584 WP_000121528.1.96588 WP_000121528.1.96735 WP_000121528.1.96876 WP_000121528.1.96993 WP_000121528.1.97103 WP_000121528.1.97322 WP_000121528.1.97328 WP_000121528.1.97547 WP_000121528.1.97648 WP_000121528.1.97656 WP_000121528.1.97704 WP_000121528.1.9774 WP_000121528.1.9793 WP_000121528.1.97981 WP_000121528.1.97991 WP_000121528.1.98119 WP_000121528.1.98338 WP_000121528.1.98440 WP_000121528.1.98472 WP_000121528.1.98570 WP_000121528.1.98726 WP_000121528.1.9899 WP_000121528.1.99057 WP_000121528.1.99097 WP_000121528.1.99164 WP_000121528.1.99215 WP_000121528.1.99456 WP_000121528.1.99490 WP_000121528.1.99493 WP_000121528.1.99577 WP_000121528.1.99613 WP_000121528.1.99630 WP_000121528.1.99924 WP_000121528.1.99961 gi|529221029|ref|YP_008382470.1| gi|207858476|ref|YP_002245127.1| gi|537438408|ref|YP_008482785.1| AM933172|CDS_3274210-3276228 AM933173|CDS_3251588-3253606 CP001144|CDS_3433304-3435322 gi|198244260|ref|YP_002217200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]