SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218530418|ref|YP_002421234.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218530418|ref|YP_002421234.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.01e-36
Family Ribosomal protein L6 0.0000302
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.93e-23
Family Ribosomal protein L6 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218530418|ref|YP_002421234.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Methylobacterium extorquens CM4]
Sequence
MSRVGKKPVPVPSGVTATVTGQTVKVKGSKGELQFVVPSQVVVEFKDGAVSVQPKDQSKQ
ARSLWGTSRAQVANLVEGVSKGFEKKLEITGVGYRAAMAGKALKLSLGYSHDIEYEIPAG
ITIVTPKPTEIVVSGIDRQRVGQVAAEIREYRGPEPYKGKGVKYAGEFIFRKEGKKK
Download sequence
Identical sequences A0A0Q4WGQ8 A0A0X1SHD1 A0A1P8QUV1 A0A1W6RLW6 A9W4S5 B7L0T5
gi|163851609|ref|YP_001639652.1| 419610.Mext_2186 440085.Mchl_2464 WP_012253653.1.26548 WP_012253653.1.32918 WP_012253653.1.40058 WP_012253653.1.43831 WP_012253653.1.62458 WP_012253653.1.65134 WP_012253653.1.71994 WP_012253653.1.77525 WP_012253653.1.80864 WP_012253653.1.82277 gi|218530418|ref|YP_002421234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]