SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218528536|ref|YP_002419352.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218528536|ref|YP_002419352.1|
Domain Number 1 Region: 33-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.09e-56
Family GABA-aminotransferase-like 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218528536|ref|YP_002419352.1|
Sequence length 397
Comment class I and II aminotransferase [Methylobacterium extorquens CM4]
Sequence
MRHREQTDATDRDRTDGVHLLPKAASFGDRPLRGLDFASQDCLGLSTHPEIVATAADTLR
RFGVRSVCAAAEAGDPGLSVALERRIADFLQMEEALLCATGRAAARTVIRGLVRSTDHVV
IDAAIRSGLRESAEAATAHLHPFRHLDAEHCRARLRAIRARDAENGILVVTESLSPLDSG
TPDLAALRTLCDEYGATLLVDVTQDLGCLGEDGRGHLGLQDMLGKADLVTGSFTKSFASN
GGFVAARTRAVTACLRASEADAQALSPIQIAVLLKAFALIDEADGCERRARLMRNVLNLR
TALRERALTVCGEPCTSVSVAIGSGELARLAAPRLIELGLLVDLTASGEASRLRMHVTAE
HSDADIARAALGVAEALDRARADLAERSRRPNLLVAA
Download sequence
Identical sequences A0A0Q4X117 B7L0E6
440085.Mchl_0489 WP_012605585.1.65134 WP_012605585.1.77525 gi|218528536|ref|YP_002419352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]