SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218528704|ref|YP_002419520.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218528704|ref|YP_002419520.1|
Domain Number 1 Region: 10-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.36e-73
Family Cystathionine synthase-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218528704|ref|YP_002419520.1|
Sequence length 391
Comment phosphoserine aminotransferase [Methylobacterium extorquens CM4]
Sequence
MTAQMPAARPRVPYFSSGPTTKRPGWSLDALSGAALGRSHRSAVGKAKLAEAIELTRKVL
RIPADYRIGIVPGSDTGAVEMAMWSMLGPKSVEVMAWDSFGAEWVTDALKELRIDPKVHV
GEHGILPKLDAIDTKNNDVVFTWNGTTAGVKVPHADWIADDREGVTICDATSAAFAMPLP
WDKLDVVTYSWQKVMGGEAAHGMLILSPRAVARLESHTPAWPIPKVFRLTKGGKLIEGIF
KGETINTPSMLAVEDYIDTLNWAQSIGGLDALHARADANARVIHDWVARTPWIGHLAVDP
ATYSNTGVCLVITDSDVLAKGDAAVKAFAAALVTRLEKEGVAFDFGAYRDAPAGLRIWCG
ATVEASDLAALTPWLDWAFAQEKAALAAAAA
Download sequence
Identical sequences B7KZ62
WP_012605721.1.65134 440085.Mchl_0670 gi|218528704|ref|YP_002419520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]