SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218528720|ref|YP_002419536.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218528720|ref|YP_002419536.1|
Domain Number 1 Region: 32-410
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.6e-51
Family AAT-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218528720|ref|YP_002419536.1|
Sequence length 425
Comment GntR family transcriptional regulator [Methylobacterium extorquens CM4]
Sequence
MPSLSTLSPEALSELRSSLRGEYEALKAQSLKLDMTRGKPASDQLDLAAEMLALPGNRDT
TAEDDTDARNYGNLQGLPETRTLFAPVLGAPPEQIVIANNSSLALMHDVLVYALLKGVPG
GTGPWSKQEPITILCPVPGYDRHFALCEGFGIRMIPIPMTGEGPDMAAVEREAADPSVKG
IWCVPQYSNPSGETYSEETIRRLASLKAAAPDFRILWDNAYAVHHLTEARPTLVNILEAC
AEAGNPDRPIVFASTSKVTLAGAGLAMLAASPANVKWYLAQAGRRSIGPDKLNQLRHVRF
LRDAAGIAAHMERHRALIAPKFAAVEAAFAARLDGWEVAQWSRPLGGYFITLDVADGTAS
RVVQLAGEAGIALTPAGATHPYGKDPHDRTLRIAPTFPGLDAVRKAAEAVALCTLLGAVE
ARAAA
Download sequence
Identical sequences B7KZ78
440085.Mchl_0686 WP_012605733.1.65134 gi|218528720|ref|YP_002419536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]