SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218529445|ref|YP_002420261.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218529445|ref|YP_002420261.1|
Domain Number 1 Region: 13-443
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.07e-114
Family GABA-aminotransferase-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218529445|ref|YP_002420261.1|
Sequence length 445
Comment beta alanine--pyruvate transaminase [Methylobacterium extorquens CM4]
Sequence
MSASIKGNSPKTEAFWMPFTANRQFKASPRILVAADGMYYTSDDGRPVLDGTAGLWCVNA
GHGRRRIAEAVERQLATLDFAPTFQMGHPAAFDFAERLAEIAPGPDGQRLDRIFFTGSGS
ESVDTALKIALAYQRAIGQGTRTRLIGRERGYHGVGFGGISVGGILNNRRAFPTLTGTDH
LRHTHDLARNAFTKGQPEHGAELADDLERLVALHGAETIAACIVEPVAGSTGVLIPPKGY
LERLREICTRHGILLIFDEVITGFGRLGAPFATNFFGVTPDLVATAKGLTNGVIPMGAVF
ASRPIHDALMQGPEGLIELFHGYTYSGHPVASAAGIATLSIYAEEGLLTRAASLSEDWAS
AVHALHDARHVIDIRTIGLIAGIELRSRDGAPGARAYEVFVDCFERGLLVRVTGDIIALS
PPLIIDREQISSAVATLADALDRLA
Download sequence
Identical sequences A9W289 B7KRX1 C7CIQ3
gi|163850723|ref|YP_001638766.1| WP_012252928.1.40058 WP_012252928.1.60027 WP_012252928.1.62458 WP_012252928.1.65134 419610.Mext_1294 440085.Mchl_1456 661410.METDI1882 gi|218529445|ref|YP_002420261.1| gi|254560348|ref|YP_003067443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]