SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218531034|ref|YP_002421850.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218531034|ref|YP_002421850.1|
Domain Number 1 Region: 43-398
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.8e-96
Family Cystathionine synthase-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218531034|ref|YP_002421850.1|
Sequence length 405
Comment cystathionine gamma-synthase [Methylobacterium extorquens CM4]
Sequence
MSRSNAPHGTSDAAPSEALSPAEWQPATLAAQALGRIDPVTRAVVPPLHLSTTYLRDADN
AYRSGFVYARPDNATTREAEDVIAALERAEAGALLFGSGMAAASAVFCALERGDHVIAPE
VMYWGLRRWLRQEAPRLDLAVDFMPMDDPEAVRAAIRPGKTRLVWIETPGNPLCTVADIA
RIAEIAHAAGARVAVDSTAASPILTRPLTLGADIVMHSATKILNGHSDVVAGVLAGARKD
AFWDRLVAIRGGWGAILGPFEAYLLMRGLRTLPLRAAAQSAGALHLAQRLSAHPLVSAVL
YPGLPDHPGHAVAARQMTGGFGYMLSIRVAGGEAAAIETAARVALWKRATSLGGVESLIE
HRASVEGPGTPCPPDLLRLSTGIEDPDDLLRDLDAALTGAHGPTE
Download sequence
Identical sequences B7KS37
gi|218531034|ref|YP_002421850.1| WP_015951303.1.65134 440085.Mchl_3084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]