SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218531343|ref|YP_002422159.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218531343|ref|YP_002422159.1|
Domain Number 1 Region: 1-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.29e-104
Family AAT-like 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218531343|ref|YP_002422159.1|
Sequence length 406
Comment aminotransferase [Methylobacterium extorquens CM4]
Sequence
MTDFHRIKRLPPYVFEQVNRIKAAARARGADIIDLGMGNPDLDAPRHVIEKLVETAGKPR
TDRYSASKGIAGLRRAQAGYYQRRFGVSLNPDTQVVATLGSKEGFANMAQAITAPGDVVL
VPNPSYPIHAFGFLMAGGVIRSVPAEPTPAMFPALEKAVVHSIPKPVALVVCYPSNPTAY
VASLDFYRDLVAFAKKHELILLSDLAYAEVYFDDNNPPPSVLQVPGAIDCTVEFTSLSKT
FSMAGWRMGFAVGNERLLAALTRVKSYLDYGAFTPIQVAATAALNGPDDCIKEMRATYKK
RRDALVESFGKAGWKLPTPEASMFAWVPIPEKFRDLGSLEFSKLLLEKSDVAVAPGIGFG
EHGDDYVRIALVENEQRIRQAARNVRRFFDNADRTLHNVVPLQKAV
Download sequence
Identical sequences B7KUK2 C5AXH4 H1KKF4
gi|240139842|ref|YP_002964319.1| gi|218531343|ref|YP_002422159.1| WP_003600977.1.1114 WP_003600977.1.3851 WP_003600977.1.65134 272630.MexAM1_META1p3302 440085.Mchl_3411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]