SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218531405|ref|YP_002422221.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218531405|ref|YP_002422221.1|
Domain Number 1 Region: 9-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.91e-116
Family Cystathionine synthase-like 0.0000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218531405|ref|YP_002422221.1|
Sequence length 435
Comment O-acetylhomoserine/O-acetylserine sulfhydrylase [Methylobacterium extorquens CM4]
Sequence
MTAEPKTLRFATQAVHAGAAPDPATGARVQPIYFTNGFVFDSTEQAADIFAMRKTGFSYS
RGSNPTVAALERRVAALEGAKAAVAVSSGQSAVLLVMMTLMQTGDAYVASPRLFGGSLGL
MRRLEGRYDLTPQFAADLTPEAFEAAITPQTKAIICESIVNPCATVMDIEGIAAVAKRHG
LPLVIDNTLASPALIRPIEYGADIIVHSTSKFLGGSGQVIGGMICDAGTFDWKAQGSRYN
LINDPWPDYDGLIVSDRFPEISFAVACRLFGLRDLGPGLSPMNAFLTLTGIETLPLRMER
HCANAKAVAAYLKDHPAVDWVSYPALPGQKGEALANRYVPQGPGSIFTFALKGGEPAALA
FIANLELVSHLVNIGEIKSLVIHPATTTHRQLRPEERAAACVGPETVRLSIGLEDPEDLI
ADIEQALAKVGAQIG
Download sequence
Identical sequences A0A0Q4WRJ6 A9VYU5 B7KUR4 C5AXN1 H1KEZ2
gi|218531405|ref|YP_002422221.1| WP_003597927.1.1114 WP_003597927.1.3851 WP_003597927.1.40058 WP_003597927.1.62458 WP_003597927.1.65134 WP_003597927.1.77525 gi|240139899|ref|YP_002964376.1| gi|163852565|ref|YP_001640608.1| 272630.MexAM1_META1p3362 419610.Mext_3149 440085.Mchl_3473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]