SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218531427|ref|YP_002422243.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218531427|ref|YP_002422243.1|
Domain Number 1 Region: 15-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.79e-179
Family GABA-aminotransferase-like 0.000000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218531427|ref|YP_002422243.1|
Sequence length 434
Comment serine hydroxymethyltransferase [Methylobacterium extorquens CM4]
Sequence
MSAGTATDTTDLDSFFSAHLAETDPEIAKAISQELGRQQHEIELIASENIVSRAVLEAQG
SVLTNKYAEGYPGRRYYGGCQFVDIAEELAIDRAKRLFGCGFANVQPNSGSQANQGVFMA
LMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVERLAQEHKP
KVIIAGGSGYPRHWDFAKFREIADSVGAYFFVDMAHFAGLVAAGLHPSPFPHAHVATTTT
HKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALKPEFKIYAK
QVIDNARALADTIISGGYDITSGGTDNHLMLVDLQKKGLTGKAAEAALSRADITCNKNGV
PFDPQKPTITSGIRLGTPASTTRGFGVAEFKQVGSLIVQVLDGIAEKGDGGDAAVEAAVK
EKVHALTDRFPIYA
Download sequence
Identical sequences A0A0Q4WRY1 A0A1P8QSB5 A9VYW6 B7KVA7 C7CC47 H1KKN4 P50435
272630.MexAM1_META1p3384 419610.Mext_3171 440085.Mchl_3495 661410.METDI3959 gi|240139921|ref|YP_002964398.1| gi|163852586|ref|YP_001640629.1| gi|254562345|ref|YP_003069440.1| WP_003601128.1.1114 WP_003601128.1.3851 WP_003601128.1.40058 WP_003601128.1.60027 WP_003601128.1.62458 WP_003601128.1.65134 WP_003601128.1.71994 WP_003601128.1.77525 WP_003601128.1.82277 gi|218531427|ref|YP_002422243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]