SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218532236|ref|YP_002423052.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218532236|ref|YP_002423052.1|
Domain Number 1 Region: 14-413
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.76e-126
Family Cystathionine synthase-like 0.0000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218532236|ref|YP_002423052.1|
Sequence length 418
Comment SufS subfamily cysteine desulfurase [Methylobacterium extorquens CM4]
Sequence
MNAPVRTTAQDSSYDVEAIRKEFPILSEKVYGKPLVYLDNAASTQKPRAVIDAMVSCMET
GYANVHRGLHYMANAATEGFEGARETTRQFLNAASTDEIIFTRNATEAYNLVASSMGWAG
LIGEGDEIILSIMEHHSNIVPWHFLRERRGAVIKWAPVDDDGNFLIEEYEKLFTPRTKMV
AITHMSNVLGTVTPAEEIVRIAHAHGVPVLLDGAQSAVHRPVDVRALDCDFFVFTGHKVY
GPTGIGVLYGKKEWLDRLPPYQGGGEMIRTVSQDAITYNDPPHRFEAGTPAIIEAVGLGA
ALEFMMKLGRDKIAAHEAMLTAYAQERLGAMNSIRQIGNSRDKGGVIAFEVKGAHAHDIA
TVIDHQGVAVRAGTHCAMPLLTRFGVTSTCRASFGLYNTTQEIDVLAAALAKAEMLFA
Download sequence
Identical sequences A0A0Q4WQW1 B7L2T0
440085.Mchl_4348 gi|218532236|ref|YP_002423052.1| WP_015952224.1.26548 WP_015952224.1.32918 WP_015952224.1.65134 WP_015952224.1.77525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]