SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218532330|ref|YP_002423146.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218532330|ref|YP_002423146.1|
Domain Number 1 Region: 6-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.61e-123
Family GABA-aminotransferase-like 0.000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218532330|ref|YP_002423146.1|
Sequence length 396
Comment acetylornithine and succinylornithine aminotransferase [Methylobacterium extorquens CM4]
Sequence
MTSALLPTYARAPIAFERGEGAWLVAEDGDRYLDFGAGIAVNALGHAHPHLVEALTTQAQ
KLWHTSNLFQIPEGERLGQRLVDATFADVAFFANSGAEANEAAIKMARKYHAAGGHPERY
RIITFEGAFHGRTLATIAAGGQQKYIEGFGPKVEGFDQVPVGDFAALEAVIGPETAALMI
EPIQGEGGLRVIPGETLRRLRALCEAHGLLLIMDEVQTGVGRTGKFFAHEWSGVTPDIMS
AAKGIGGGFPLGVCLATAEAARGMTAGTHGTTFGGNPLAMAVGNAVLDVVLGDGFLAHVE
RMDLLLTQKLAGLIDRHPHVFAELRGQGLMRGLKLNLPNTAFTAAARARHLLVIPAGDNV
VRLLPPLIVGETEVDEAVARLEAAATDLEAQMRGAA
Download sequence
Identical sequences B7KNA1 C7CJI1
gi|254563402|ref|YP_003070497.1| 440085.Mchl_4442 661410.METDI5069 WP_015824209.1.60027 WP_015824209.1.65134 gi|218532330|ref|YP_002423146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]