SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218532458|ref|YP_002423274.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218532458|ref|YP_002423274.1|
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.57e-106
Family Cystathionine synthase-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218532458|ref|YP_002423274.1|
Sequence length 391
Comment serine--glyoxylate transaminase [Methylobacterium extorquens CM4]
Sequence
MTHRTGRHFLHIPGPSPVPERVLRAMDRQVIDHRGPDFGVLGREVLEGCRTIFRTRGPVV
IYPGSGTGAWEAAIVNTLSSGDRVLMFETGHFATLWRQMAARWGIAVEFVPGDWRHGVDP
ALVEAKLAEDRSHSFKAVMVVHNETSTGVTSRIPAIRKAIDAAGHPALLLVDTISSLGSV
DVRHDEWGVDVTVSGSQKGLMLPPGLSFTAISEKARAAGKSNNLPRSYWDWEEMLKPNAN
GYFPYTPATNLLYGLREAVAILLEEGLDNVFARHQRLAAATRAAVEAWGLEVLCLNPDEH
SPVLTAVMMPDGKGADAFRALVLEKFDMSLGAGLSKLADKIFRIGHLGETNDLTLMGALS
GVEMGLAAASVPHRPGGVLAAMASLRSGLDG
Download sequence
Identical sequences B7KP94
WP_015952374.1.65134 gi|218532458|ref|YP_002423274.1| 440085.Mchl_4570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]