SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218533322|ref|YP_002424137.1| from Methylobacterium chloromethanicum CM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218533322|ref|YP_002424137.1|
Domain Number 1 Region: 9-378
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.77e-72
Family GABA-aminotransferase-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218533322|ref|YP_002424137.1|
Sequence length 385
Comment phosphoserine aminotransferase [Methylobacterium extorquens CM4]
Sequence
MPDRPAARPRVPYFSSGPTTKRPGWSLDALSGAALGRSHRSAVGKAKLAEAIELTRKVLR
IPADYRIGIVPGSDTGAVEMAMWSMLGPKPVEVMAWDSFGAEWVTDALKELRIDPKVHIG
EHGILPKLDAIDTKNNDVVFTWNGTTAGVKVPHADWIADDREGVMICDATSAAFAMPLPW
DKLDVVTYSWQKVMGGEAAHGMLILSPRAVARLESHTPAWPIPKVFRLTKGGKLLEGIFK
GETINTPSMLAVEDYLDTLKWAQSIGGLDALHARADANARVIHDWVARTPWIGHLAVDPA
TYSNTGVCLVITDPDVLAKGDAVVKKVAAGIVTRLESEGVAFDFGAYRDAPAGLRIWCGA
TVEASDLAALTPWLDWAFAQEQRQL
Download sequence
Identical sequences B7L301
WP_012606112.1.65134 gi|218533322|ref|YP_002424137.1|NC_011758 gi|218533322|ref|YP_002424137.1| 440085.Mchl_5460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]