SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212638197|ref|YP_002314717.1| from Anoxybacillus flavithermus WK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212638197|ref|YP_002314717.1|
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 1.24e-48
Family Hypothetical protein YfhH 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212638197|ref|YP_002314717.1|
Sequence length 109
Comment hypothetical protein Aflv_0348 [Anoxybacillus flavithermus WK1]
Sequence
MGKMDQKRYSEMSERELKQEIAMLTEKARKAEQMGMVNEYAVYERKIAMAKAYLLNPNDF
QPGEFYEIEGDPHSLFKLQYMNGVFAWGYRLSDPNTEVALPISLLKKRG
Download sequence
Identical sequences A0A1V3FL07 A0A223FD76 B7GII5 R4FDL5
WP_006322045.1.13911 WP_006322045.1.34884 WP_006322045.1.68149 WP_006322045.1.82098 gi|212638197|ref|YP_002314717.1| 491915.Aflv_0348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]