SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212638982|ref|YP_002315502.1| from Anoxybacillus flavithermus WK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212638982|ref|YP_002315502.1|
Domain Number 1 Region: 431-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212638982|ref|YP_002315502.1|
Sequence length 581
Comment sulfate permease MFS superfamily [Anoxybacillus flavithermus WK1]
Sequence
MKRFHGYTMAHFQKDLLSGCIVGVIALPLGMAFAIASGVKPEYGIYTTIVAGILISLFGG
SKYQIGGPTGAFIPILLGIVLTYGYENLLVAGFLSGIMLVSFGVFRLGSLIKFIPRPVTI
GFTAGIAVIIFTGQIPNFLGLNVKKHEAFVDNMKEIWMHLDDVNIYSVIIASIGLVVLLF
APKVAPKIPSPLLSLVVSSLFAFFLFENKVATIGSVYGEIPNTLPHISVPHFTLENIYEM
IRPAFVIAMLGAIESLLSAVVADGMTGEKHHSNRELIGQGIANIVTPFFGGIPATGAIAR
TATNIKSGATSPLSGVIHGIVVLIILLIFSPYASHIPLASMAPILMIVAWNMSERKEFMH
VLKMKSADSIVLVITFILTIFVNLTIAVEVGLILAVLLFAKRMTEVFRVLKVLPDERKKK
VSPTMVEQGRDCPQISIYTIDGPLFFGVAQMFEQSIMATIHHTPRVLVLRMGKVPYIDQT
GEANLASLIKHFQAKGGVVFISGIQQQPKEMLKRSGLYDTIGAENFFEHTGEALQAAFSH
INRMQCFGCKHYAFSECRQLCHMSEEQMVNHFKTEYVGGSK
Download sequence
Identical sequences B7GHU5
gi|212638982|ref|YP_002315502.1| 491915.Aflv_1141 WP_012574770.1.82098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]