SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212639356|ref|YP_002315876.1| from Anoxybacillus flavithermus WK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212639356|ref|YP_002315876.1|
Domain Number 1 Region: 196-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.62e-75
Family PFOR Pyr module 0.012
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.72e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0027
Further Details:      
 
Domain Number 3 Region: 468-577
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.38e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212639356|ref|YP_002315876.1|
Sequence length 578
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [Anoxybacillus flavithermus WK1]
Sequence
MISQLSWKVGGQQGEGIESTGEIFSIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTQ
VRSIADDLDILVAFDQETIDFNFHELRQGGIVIADAKFNPTIPDESRATLYAVPFTDIAT
ELGTALMKNMVAVGASSAVLGLDISVYEGVVQEIFGRKGEQVVAKNMEAIRAGAQFMREQ
LGDNIQLMQLEKADGKKRMFMIGNDAIALGALAGGARFMAAYPITPASEIMEYLIKKLPQ
FGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGITETPIVIVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKVVMAPSTVQEAFYDMVEAFNIAEEYQCPVI
VLTDLQLSLGKQTVEPLEYDKIEIRRGKLVTGELPEIPDKGCFKRYEVTEDGVSPRVLPG
MKNGIHHVTGVEHDETGRPSEVAANRIAQMDKRLRKLKHIQFPTPVHKHVKHEEADVLIV
GFNSTRGAIEEAMERLERDGIKVNHAHVRLIHPFPTEEMLPLVQSAKKVVVVENNATGQL
ANILKMNVGHAEKVFNVLKYDGNPFLPHEVYTKCKELF
Download sequence
Identical sequences A0A1V3FRV9 B7GJM8 R4FGZ9
WP_006323457.1.13911 WP_006323457.1.68149 WP_006323457.1.82098 491915.Aflv_1525 gi|212639356|ref|YP_002315876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]