SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197248565|ref|YP_002147529.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197248565|ref|YP_002147529.1|
Domain Number 1 Region: 4-248
Classification Level Classification E-value
Superfamily SIS domain 1.09e-74
Family mono-SIS domain 0.000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197248565|ref|YP_002147529.1|
Sequence length 297
Comment N-acetylmuramic acid 6-phosphate etherase [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MNLGTLVSETRNPQTMDLDALSTPELVKRFNEQDTRVAEAVKATLPDVARAVDAAAAALK
SGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALLKAVEGAEDSQQAG
EDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYARQSGCTTVAVSCNPDSPIAREANIAI
SPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVDMKATNVKLVDRACR
MVVEATGIGREEAETLLKQTDFEVKPAILMALTGLDAAAAREKLAAHQGFLRAALEH
Download sequence
Identical sequences B5F1F1
454166.SeAg_B2733 WP_001048541.1.100007 WP_001048541.1.10013 WP_001048541.1.100721 WP_001048541.1.100773 WP_001048541.1.100790 WP_001048541.1.100932 WP_001048541.1.10507 WP_001048541.1.10797 WP_001048541.1.11369 WP_001048541.1.11621 WP_001048541.1.12047 WP_001048541.1.12059 WP_001048541.1.12063 WP_001048541.1.12650 WP_001048541.1.13829 WP_001048541.1.14528 WP_001048541.1.15479 WP_001048541.1.15978 WP_001048541.1.16052 WP_001048541.1.16158 WP_001048541.1.16565 WP_001048541.1.16656 WP_001048541.1.16826 WP_001048541.1.17949 WP_001048541.1.18445 WP_001048541.1.18919 WP_001048541.1.19469 WP_001048541.1.20023 WP_001048541.1.20081 WP_001048541.1.20795 WP_001048541.1.20839 WP_001048541.1.22623 WP_001048541.1.23080 WP_001048541.1.23258 WP_001048541.1.23675 WP_001048541.1.24696 WP_001048541.1.24837 WP_001048541.1.25205 WP_001048541.1.25514 WP_001048541.1.25703 WP_001048541.1.26384 WP_001048541.1.26883 WP_001048541.1.272 WP_001048541.1.2723 WP_001048541.1.28002 WP_001048541.1.28811 WP_001048541.1.28977 WP_001048541.1.29732 WP_001048541.1.30331 WP_001048541.1.30696 WP_001048541.1.31086 WP_001048541.1.31155 WP_001048541.1.31214 WP_001048541.1.3278 WP_001048541.1.34084 WP_001048541.1.34881 WP_001048541.1.35835 WP_001048541.1.36229 WP_001048541.1.36885 WP_001048541.1.37021 WP_001048541.1.37147 WP_001048541.1.37158 WP_001048541.1.3728 WP_001048541.1.38055 WP_001048541.1.38113 WP_001048541.1.3828 WP_001048541.1.38995 WP_001048541.1.40910 WP_001048541.1.40935 WP_001048541.1.4109 WP_001048541.1.41265 WP_001048541.1.41308 WP_001048541.1.41593 WP_001048541.1.41628 WP_001048541.1.4184 WP_001048541.1.42453 WP_001048541.1.43272 WP_001048541.1.43676 WP_001048541.1.43828 WP_001048541.1.43864 WP_001048541.1.44359 WP_001048541.1.44453 WP_001048541.1.44636 WP_001048541.1.45134 WP_001048541.1.46358 WP_001048541.1.46637 WP_001048541.1.47460 WP_001048541.1.47614 WP_001048541.1.47767 WP_001048541.1.48751 WP_001048541.1.49214 WP_001048541.1.51036 WP_001048541.1.5114 WP_001048541.1.5125 WP_001048541.1.51704 WP_001048541.1.51910 WP_001048541.1.53315 WP_001048541.1.53814 WP_001048541.1.5392 WP_001048541.1.5415 WP_001048541.1.55166 WP_001048541.1.55803 WP_001048541.1.56004 WP_001048541.1.56082 WP_001048541.1.56468 WP_001048541.1.57076 WP_001048541.1.57344 WP_001048541.1.57521 WP_001048541.1.5753 WP_001048541.1.58131 WP_001048541.1.58239 WP_001048541.1.58416 WP_001048541.1.59006 WP_001048541.1.5929 WP_001048541.1.59636 WP_001048541.1.59979 WP_001048541.1.60503 WP_001048541.1.60622 WP_001048541.1.60760 WP_001048541.1.60863 WP_001048541.1.61732 WP_001048541.1.62144 WP_001048541.1.62693 WP_001048541.1.63690 WP_001048541.1.63860 WP_001048541.1.63866 WP_001048541.1.63912 WP_001048541.1.63958 WP_001048541.1.64034 WP_001048541.1.6451 WP_001048541.1.67814 WP_001048541.1.6785 WP_001048541.1.67969 WP_001048541.1.68147 WP_001048541.1.685 WP_001048541.1.69554 WP_001048541.1.70003 WP_001048541.1.70169 WP_001048541.1.70327 WP_001048541.1.70733 WP_001048541.1.70761 WP_001048541.1.70899 WP_001048541.1.714 WP_001048541.1.72243 WP_001048541.1.72793 WP_001048541.1.74089 WP_001048541.1.74454 WP_001048541.1.75301 WP_001048541.1.75740 WP_001048541.1.76799 WP_001048541.1.7684 WP_001048541.1.77241 WP_001048541.1.7814 WP_001048541.1.78715 WP_001048541.1.78881 WP_001048541.1.79140 WP_001048541.1.79974 WP_001048541.1.80473 WP_001048541.1.81736 WP_001048541.1.81743 WP_001048541.1.83258 WP_001048541.1.84209 WP_001048541.1.85217 WP_001048541.1.85408 WP_001048541.1.85864 WP_001048541.1.86284 WP_001048541.1.86656 WP_001048541.1.8691 WP_001048541.1.87282 WP_001048541.1.87687 WP_001048541.1.88214 WP_001048541.1.88683 WP_001048541.1.88970 WP_001048541.1.91864 WP_001048541.1.92099 WP_001048541.1.92394 WP_001048541.1.92827 WP_001048541.1.94717 WP_001048541.1.95623 WP_001048541.1.95729 WP_001048541.1.96042 WP_001048541.1.96206 WP_001048541.1.96642 WP_001048541.1.98438 WP_001048541.1.9863 WP_001048541.1.99278 gi|197248565|ref|YP_002147529.1| CP001138|CDS_2679226-2678333 gi|563654020|ref|YP_008862096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]