SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197248959|ref|YP_002145292.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197248959|ref|YP_002145292.1|
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily SIS domain 3.84e-52
Family mono-SIS domain 0.0000000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197248959|ref|YP_002145292.1|
Sequence length 192
Comment phosphoheptose isomerase [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFSRYVEAVGREGDVLLGIST
SGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
Download sequence
Identical sequences A0A089GCM4 A0A0D6HD47 A0A0F5B7I6 A0A0F6AXB7 A0A0F7J3F2 A0A0H3N9K7 A0A0K0H7L8 A0A0L3JPS3 A0A0M0PTF2 A0A0R9MBU8 A0A0T9WSL0 A0A0U1FPZ5 A0A0V2D4W0 A0A1C2ZPZ3 A0A1J6Z1X1 A0A1R2JTX5 A0A1S0ZHI6 A0A1S1AMU6 A0A1X2T391 A0A1X2T8X3 A0A1X2USK6 A0A1X2Y973 A0A1Z3Q0W7 A0A221YUY0 A0A221Z3K6 A0A241SGW1 A0A248KC20 A0A265B7W7 A0A267SGV1 A0A271CC13 A0A271CUV9 A0A2C6FIX0 A0A2C9P3F0 A0A2D1XH92 A0A2D1XVA7 A0A2D3TZI5 A0A2G1P9L4 A0A2H9YC27 A0A2I5HKE9 A0A2I6MC01 A0A2I6MPI7 A0A2I6N2Y8 A0A2I6NGQ7 A0A2I6NUL0 A0A2I6P7L0 A0A2K2ZKH0 A9MY16 B4SVV2 B4T7P3 B4TYM6 B5BDQ9 B5EWJ3 B5R470 B5R5Q7 G5L4R1 G5ME60 G5RB06 G5RR29 G5S6X7 P63222 P63223 Q57SU4 Q5PF73 S5HSR9 S5N4Q7 V1HY47 V1XQH5 V7UMD0
gi|194736690|ref|YP_002113336.1| gi|378443757|ref|YP_005231389.1| gi|16763693|ref|NP_459308.1| gi|488655031|ref|YP_007926834.1| gi|16759305|ref|NP_454922.1| gi|161615520|ref|YP_001589485.1| NP_454922.1.84458 NP_459308.1.58477 WP_000284051.1.100002 WP_000284051.1.100007 WP_000284051.1.100008 WP_000284051.1.100010 WP_000284051.1.100031 WP_000284051.1.100036 WP_000284051.1.100077 WP_000284051.1.100079 WP_000284051.1.100115 WP_000284051.1.100129 WP_000284051.1.10013 WP_000284051.1.100137 WP_000284051.1.100149 WP_000284051.1.100165 WP_000284051.1.100191 WP_000284051.1.100196 WP_000284051.1.1002 WP_000284051.1.100234 WP_000284051.1.100258 WP_000284051.1.100266 WP_000284051.1.100284 WP_000284051.1.100288 WP_000284051.1.100313 WP_000284051.1.100314 WP_000284051.1.100321 WP_000284051.1.100354 WP_000284051.1.100376 WP_000284051.1.100392 WP_000284051.1.100412 WP_000284051.1.100413 WP_000284051.1.100421 WP_000284051.1.100424 WP_000284051.1.100432 WP_000284051.1.100436 WP_000284051.1.100438 WP_000284051.1.100446 WP_000284051.1.100450 WP_000284051.1.100457 WP_000284051.1.100472 WP_000284051.1.100484 WP_000284051.1.100488 WP_000284051.1.100502 WP_000284051.1.100519 WP_000284051.1.100521 WP_000284051.1.100541 WP_000284051.1.100557 WP_000284051.1.100584 WP_000284051.1.100589 WP_000284051.1.100592 WP_000284051.1.100597 WP_000284051.1.100605 WP_000284051.1.100610 WP_000284051.1.100642 WP_000284051.1.10065 WP_000284051.1.100650 WP_000284051.1.100707 WP_000284051.1.100711 WP_000284051.1.100714 WP_000284051.1.100721 WP_000284051.1.100730 WP_000284051.1.100732 WP_000284051.1.100733 WP_000284051.1.100739 WP_000284051.1.10074 WP_000284051.1.100750 WP_000284051.1.10076 WP_000284051.1.100764 WP_000284051.1.100773 WP_000284051.1.100776 WP_000284051.1.100781 WP_000284051.1.100790 WP_000284051.1.100793 WP_000284051.1.100799 WP_000284051.1.10081 WP_000284051.1.100814 WP_000284051.1.100857 WP_000284051.1.100865 WP_000284051.1.100869 WP_000284051.1.100870 WP_000284051.1.100871 WP_000284051.1.100882 WP_000284051.1.100886 WP_000284051.1.100895 WP_000284051.1.100932 WP_000284051.1.100941 WP_000284051.1.100944 WP_000284051.1.100948 WP_000284051.1.100953 WP_000284051.1.101007 WP_000284051.1.101011 WP_000284051.1.101020 WP_000284051.1.101042 WP_000284051.1.101074 WP_000284051.1.101078 WP_000284051.1.10108 WP_000284051.1.101088 WP_000284051.1.101091 WP_000284051.1.101094 WP_000284051.1.101111 WP_000284051.1.101112 WP_000284051.1.101123 WP_000284051.1.101126 WP_000284051.1.101147 WP_000284051.1.101180 WP_000284051.1.101185 WP_000284051.1.101199 WP_000284051.1.101223 WP_000284051.1.101226 WP_000284051.1.101239 WP_000284051.1.10124 WP_000284051.1.101259 WP_000284051.1.101271 WP_000284051.1.101284 WP_000284051.1.101291 WP_000284051.1.1013 WP_000284051.1.101312 WP_000284051.1.101320 WP_000284051.1.101322 WP_000284051.1.101353 WP_000284051.1.101363 WP_000284051.1.101374 WP_000284051.1.101386 WP_000284051.1.101404 WP_000284051.1.101420 WP_000284051.1.101425 WP_000284051.1.101454 WP_000284051.1.101473 WP_000284051.1.101519 WP_000284051.1.101520 WP_000284051.1.101541 WP_000284051.1.101543 WP_000284051.1.101589 WP_000284051.1.101609 WP_000284051.1.101612 WP_000284051.1.101616 WP_000284051.1.101634 WP_000284051.1.101636 WP_000284051.1.101639 WP_000284051.1.10164 WP_000284051.1.101666 WP_000284051.1.101674 WP_000284051.1.101707 WP_000284051.1.101724 WP_000284051.1.101734 WP_000284051.1.101740 WP_000284051.1.101741 WP_000284051.1.101759 WP_000284051.1.10177 WP_000284051.1.101776 WP_000284051.1.101815 WP_000284051.1.101832 WP_000284051.1.101839 WP_000284051.1.101841 WP_000284051.1.101868 WP_000284051.1.101878 WP_000284051.1.101890 WP_000284051.1.101904 WP_000284051.1.10191 WP_000284051.1.101917 WP_000284051.1.101941 WP_000284051.1.101949 WP_000284051.1.101953 WP_000284051.1.101975 WP_000284051.1.102009 WP_000284051.1.102050 WP_000284051.1.102087 WP_000284051.1.102103 WP_000284051.1.102111 WP_000284051.1.10220 WP_000284051.1.10231 WP_000284051.1.10237 WP_000284051.1.10266 WP_000284051.1.10276 WP_000284051.1.10293 WP_000284051.1.10300 WP_000284051.1.10310 WP_000284051.1.10338 WP_000284051.1.1038 WP_000284051.1.10394 WP_000284051.1.104 WP_000284051.1.10401 WP_000284051.1.10428 WP_000284051.1.10429 WP_000284051.1.10439 WP_000284051.1.10459 WP_000284051.1.10463 WP_000284051.1.10465 WP_000284051.1.10475 WP_000284051.1.10498 WP_000284051.1.10507 WP_000284051.1.10511 WP_000284051.1.10514 WP_000284051.1.10521 WP_000284051.1.10530 WP_000284051.1.10532 WP_000284051.1.10547 WP_000284051.1.10562 WP_000284051.1.10566 WP_000284051.1.10568 WP_000284051.1.10595 WP_000284051.1.106 WP_000284051.1.10631 WP_000284051.1.10642 WP_000284051.1.10654 WP_000284051.1.10675 WP_000284051.1.10677 WP_000284051.1.10678 WP_000284051.1.10711 WP_000284051.1.10720 WP_000284051.1.10753 WP_000284051.1.10755 WP_000284051.1.10797 WP_000284051.1.10857 WP_000284051.1.10868 WP_000284051.1.10873 WP_000284051.1.10898 WP_000284051.1.10926 WP_000284051.1.10936 WP_000284051.1.10992 WP_000284051.1.11000 WP_000284051.1.11012 WP_000284051.1.11024 WP_000284051.1.11031 WP_000284051.1.11041 WP_000284051.1.11055 WP_000284051.1.11098 WP_000284051.1.1110 WP_000284051.1.11119 WP_000284051.1.11126 WP_000284051.1.11142 WP_000284051.1.11156 WP_000284051.1.11168 WP_000284051.1.11190 WP_000284051.1.11213 WP_000284051.1.11216 WP_000284051.1.11239 WP_000284051.1.11253 WP_000284051.1.11254 WP_000284051.1.11295 WP_000284051.1.113 WP_000284051.1.11304 WP_000284051.1.11314 WP_000284051.1.1135 WP_000284051.1.11362 WP_000284051.1.11369 WP_000284051.1.1137 WP_000284051.1.11385 WP_000284051.1.11386 WP_000284051.1.11405 WP_000284051.1.1142 WP_000284051.1.11426 WP_000284051.1.11429 WP_000284051.1.11444 WP_000284051.1.11455 WP_000284051.1.11458 WP_000284051.1.11479 WP_000284051.1.1150 WP_000284051.1.11511 WP_000284051.1.11518 WP_000284051.1.11526 WP_000284051.1.11528 WP_000284051.1.11532 WP_000284051.1.11543 WP_000284051.1.11544 WP_000284051.1.11557 WP_000284051.1.1156 WP_000284051.1.11565 WP_000284051.1.11567 WP_000284051.1.11588 WP_000284051.1.11603 WP_000284051.1.11621 WP_000284051.1.11638 WP_000284051.1.11677 WP_000284051.1.11681 WP_000284051.1.11687 WP_000284051.1.1169 WP_000284051.1.11735 WP_000284051.1.1174 WP_000284051.1.11763 WP_000284051.1.11772 WP_000284051.1.11810 WP_000284051.1.11824 WP_000284051.1.11834 WP_000284051.1.11841 WP_000284051.1.11865 WP_000284051.1.11868 WP_000284051.1.11875 WP_000284051.1.11883 WP_000284051.1.11897 WP_000284051.1.11900 WP_000284051.1.11908 WP_000284051.1.11914 WP_000284051.1.11936 WP_000284051.1.11938 WP_000284051.1.11964 WP_000284051.1.11978 WP_000284051.1.12007 WP_000284051.1.12017 WP_000284051.1.12025 WP_000284051.1.12027 WP_000284051.1.12040 WP_000284051.1.12047 WP_000284051.1.12059 WP_000284051.1.12061 WP_000284051.1.12063 WP_000284051.1.1207 WP_000284051.1.12106 WP_000284051.1.12114 WP_000284051.1.12141 WP_000284051.1.12144 WP_000284051.1.1215 WP_000284051.1.12159 WP_000284051.1.12160 WP_000284051.1.12168 WP_000284051.1.12172 WP_000284051.1.12192 WP_000284051.1.12210 WP_000284051.1.1224 WP_000284051.1.12244 WP_000284051.1.12280 WP_000284051.1.12282 WP_000284051.1.12308 WP_000284051.1.1232 WP_000284051.1.12340 WP_000284051.1.12351 WP_000284051.1.12364 WP_000284051.1.12370 WP_000284051.1.12374 WP_000284051.1.12396 WP_000284051.1.12397 WP_000284051.1.12398 WP_000284051.1.12441 WP_000284051.1.12456 WP_000284051.1.1246 WP_000284051.1.12472 WP_000284051.1.12484 WP_000284051.1.12485 WP_000284051.1.1250 WP_000284051.1.12546 WP_000284051.1.12568 WP_000284051.1.12569 WP_000284051.1.12581 WP_000284051.1.12584 WP_000284051.1.12585 WP_000284051.1.12620 WP_000284051.1.1264 WP_000284051.1.12648 WP_000284051.1.12650 WP_000284051.1.12683 WP_000284051.1.12696 WP_000284051.1.12701 WP_000284051.1.12718 WP_000284051.1.12726 WP_000284051.1.12727 WP_000284051.1.12728 WP_000284051.1.12741 WP_000284051.1.12834 WP_000284051.1.12864 WP_000284051.1.12865 WP_000284051.1.12877 WP_000284051.1.12879 WP_000284051.1.12936 WP_000284051.1.1299 WP_000284051.1.12995 WP_000284051.1.1300 WP_000284051.1.13027 WP_000284051.1.13076 WP_000284051.1.13101 WP_000284051.1.13102 WP_000284051.1.13106 WP_000284051.1.13108 WP_000284051.1.13130 WP_000284051.1.13161 WP_000284051.1.13207 WP_000284051.1.1321 WP_000284051.1.13247 WP_000284051.1.1326 WP_000284051.1.13262 WP_000284051.1.13268 WP_000284051.1.13274 WP_000284051.1.13291 WP_000284051.1.133 WP_000284051.1.13311 WP_000284051.1.13314 WP_000284051.1.13334 WP_000284051.1.13338 WP_000284051.1.13342 WP_000284051.1.13352 WP_000284051.1.13367 WP_000284051.1.13391 WP_000284051.1.13406 WP_000284051.1.13414 WP_000284051.1.13429 WP_000284051.1.13440 WP_000284051.1.13443 WP_000284051.1.13446 WP_000284051.1.1346 WP_000284051.1.13476 WP_000284051.1.13488 WP_000284051.1.13509 WP_000284051.1.13528 WP_000284051.1.13543 WP_000284051.1.13573 WP_000284051.1.13599 WP_000284051.1.13602 WP_000284051.1.13625 WP_000284051.1.13661 WP_000284051.1.13669 WP_000284051.1.13677 WP_000284051.1.13686 WP_000284051.1.13691 WP_000284051.1.1372 WP_000284051.1.13732 WP_000284051.1.13741 WP_000284051.1.13750 WP_000284051.1.13764 WP_000284051.1.13799 WP_000284051.1.13812 WP_000284051.1.13819 WP_000284051.1.1382 WP_000284051.1.13827 WP_000284051.1.13829 WP_000284051.1.13848 WP_000284051.1.13857 WP_000284051.1.1387 WP_000284051.1.13908 WP_000284051.1.13932 WP_000284051.1.13967 WP_000284051.1.13968 WP_000284051.1.1397 WP_000284051.1.13972 WP_000284051.1.13980 WP_000284051.1.140 WP_000284051.1.14001 WP_000284051.1.1401 WP_000284051.1.14011 WP_000284051.1.14041 WP_000284051.1.14050 WP_000284051.1.14056 WP_000284051.1.1408 WP_000284051.1.14089 WP_000284051.1.14099 WP_000284051.1.14111 WP_000284051.1.1412 WP_000284051.1.14120 WP_000284051.1.14123 WP_000284051.1.14150 WP_000284051.1.14151 WP_000284051.1.14191 WP_000284051.1.14197 WP_000284051.1.14212 WP_000284051.1.14239 WP_000284051.1.14280 WP_000284051.1.14286 WP_000284051.1.14296 WP_000284051.1.14320 WP_000284051.1.14333 WP_000284051.1.14369 WP_000284051.1.14379 WP_000284051.1.14399 WP_000284051.1.1440 WP_000284051.1.14406 WP_000284051.1.14410 WP_000284051.1.14436 WP_000284051.1.14444 WP_000284051.1.14446 WP_000284051.1.14458 WP_000284051.1.14466 WP_000284051.1.14467 WP_000284051.1.14474 WP_000284051.1.14495 WP_000284051.1.14500 WP_000284051.1.14505 WP_000284051.1.14516 WP_000284051.1.14519 WP_000284051.1.14524 WP_000284051.1.14526 WP_000284051.1.14528 WP_000284051.1.14550 WP_000284051.1.14554 WP_000284051.1.14575 WP_000284051.1.146 WP_000284051.1.14618 WP_000284051.1.14688 WP_000284051.1.14701 WP_000284051.1.14703 WP_000284051.1.14706 WP_000284051.1.14708 WP_000284051.1.14719 WP_000284051.1.14725 WP_000284051.1.1473 WP_000284051.1.14737 WP_000284051.1.14765 WP_000284051.1.14789 WP_000284051.1.14793 WP_000284051.1.14808 WP_000284051.1.14810 WP_000284051.1.14819 WP_000284051.1.14852 WP_000284051.1.14876 WP_000284051.1.14877 WP_000284051.1.14884 WP_000284051.1.1489 WP_000284051.1.14894 WP_000284051.1.14913 WP_000284051.1.14917 WP_000284051.1.14927 WP_000284051.1.14930 WP_000284051.1.14932 WP_000284051.1.14936 WP_000284051.1.14947 WP_000284051.1.14948 WP_000284051.1.14964 WP_000284051.1.15011 WP_000284051.1.15046 WP_000284051.1.15054 WP_000284051.1.15055 WP_000284051.1.15059 WP_000284051.1.15067 WP_000284051.1.15079 WP_000284051.1.15100 WP_000284051.1.15102 WP_000284051.1.15124 WP_000284051.1.15184 WP_000284051.1.15223 WP_000284051.1.15226 WP_000284051.1.15244 WP_000284051.1.15265 WP_000284051.1.15276 WP_000284051.1.15316 WP_000284051.1.15318 WP_000284051.1.15353 WP_000284051.1.15362 WP_000284051.1.15369 WP_000284051.1.1540 WP_000284051.1.15415 WP_000284051.1.15423 WP_000284051.1.15439 WP_000284051.1.15468 WP_000284051.1.15479 WP_000284051.1.15483 WP_000284051.1.15486 WP_000284051.1.15487 WP_000284051.1.15508 WP_000284051.1.1551 WP_000284051.1.15535 WP_000284051.1.15581 WP_000284051.1.15585 WP_000284051.1.15586 WP_000284051.1.15597 WP_000284051.1.15612 WP_000284051.1.15616 WP_000284051.1.15625 WP_000284051.1.15627 WP_000284051.1.15637 WP_000284051.1.15644 WP_000284051.1.15667 WP_000284051.1.1568 WP_000284051.1.15708 WP_000284051.1.15710 WP_000284051.1.15717 WP_000284051.1.15777 WP_000284051.1.15784 WP_000284051.1.15795 WP_000284051.1.158 WP_000284051.1.15830 WP_000284051.1.15835 WP_000284051.1.15862 WP_000284051.1.15881 WP_000284051.1.15905 WP_000284051.1.15909 WP_000284051.1.15910 WP_000284051.1.15912 WP_000284051.1.1592 WP_000284051.1.15922 WP_000284051.1.15938 WP_000284051.1.15944 WP_000284051.1.15970 WP_000284051.1.15978 WP_000284051.1.15986 WP_000284051.1.15995 WP_000284051.1.16000 WP_000284051.1.16004 WP_000284051.1.16006 WP_000284051.1.1601 WP_000284051.1.16028 WP_000284051.1.16032 WP_000284051.1.16046 WP_000284051.1.16047 WP_000284051.1.16051 WP_000284051.1.16052 WP_000284051.1.16058 WP_000284051.1.16062 WP_000284051.1.16063 WP_000284051.1.16103 WP_000284051.1.1611 WP_000284051.1.16125 WP_000284051.1.16150 WP_000284051.1.16155 WP_000284051.1.16158 WP_000284051.1.16166 WP_000284051.1.16172 WP_000284051.1.16201 WP_000284051.1.16233 WP_000284051.1.16244 WP_000284051.1.1626 WP_000284051.1.16264 WP_000284051.1.16273 WP_000284051.1.16284 WP_000284051.1.16331 WP_000284051.1.16344 WP_000284051.1.16347 WP_000284051.1.1635 WP_000284051.1.16361 WP_000284051.1.16363 WP_000284051.1.16365 WP_000284051.1.16366 WP_000284051.1.16394 WP_000284051.1.16452 WP_000284051.1.16453 WP_000284051.1.16461 WP_000284051.1.16462 WP_000284051.1.16465 WP_000284051.1.16468 WP_000284051.1.16474 WP_000284051.1.16508 WP_000284051.1.16522 WP_000284051.1.16525 WP_000284051.1.16551 WP_000284051.1.16563 WP_000284051.1.16565 WP_000284051.1.16581 WP_000284051.1.16588 WP_000284051.1.16614 WP_000284051.1.16650 WP_000284051.1.16656 WP_000284051.1.16658 WP_000284051.1.16666 WP_000284051.1.16673 WP_000284051.1.1668 WP_000284051.1.16686 WP_000284051.1.16691 WP_000284051.1.167 WP_000284051.1.16704 WP_000284051.1.16710 WP_000284051.1.16729 WP_000284051.1.16732 WP_000284051.1.16735 WP_000284051.1.16736 WP_000284051.1.1674 WP_000284051.1.16767 WP_000284051.1.16781 WP_000284051.1.16786 WP_000284051.1.16804 WP_000284051.1.16817 WP_000284051.1.16819 WP_000284051.1.16826 WP_000284051.1.16846 WP_000284051.1.16855 WP_000284051.1.16858 WP_000284051.1.16873 WP_000284051.1.16879 WP_000284051.1.1689 WP_000284051.1.16893 WP_000284051.1.16896 WP_000284051.1.16903 WP_000284051.1.16905 WP_000284051.1.16910 WP_000284051.1.16916 WP_000284051.1.16941 WP_000284051.1.16942 WP_000284051.1.16944 WP_000284051.1.16948 WP_000284051.1.16949 WP_000284051.1.16965 WP_000284051.1.16972 WP_000284051.1.16998 WP_000284051.1.1700 WP_000284051.1.17031 WP_000284051.1.17049 WP_000284051.1.17058 WP_000284051.1.17060 WP_000284051.1.17078 WP_000284051.1.17093 WP_000284051.1.17098 WP_000284051.1.17105 WP_000284051.1.17188 WP_000284051.1.17202 WP_000284051.1.17219 WP_000284051.1.1722 WP_000284051.1.17270 WP_000284051.1.17285 WP_000284051.1.17302 WP_000284051.1.17307 WP_000284051.1.17308 WP_000284051.1.1733 WP_000284051.1.17368 WP_000284051.1.1737 WP_000284051.1.17390 WP_000284051.1.174 WP_000284051.1.17405 WP_000284051.1.17406 WP_000284051.1.17439 WP_000284051.1.17447 WP_000284051.1.17480 WP_000284051.1.17482 WP_000284051.1.1749 WP_000284051.1.17504 WP_000284051.1.17513 WP_000284051.1.17525 WP_000284051.1.17543 WP_000284051.1.17546 WP_000284051.1.17560 WP_000284051.1.17563 WP_000284051.1.1757 WP_000284051.1.17578 WP_000284051.1.17583 WP_000284051.1.17622 WP_000284051.1.17629 WP_000284051.1.17659 WP_000284051.1.17667 WP_000284051.1.17686 WP_000284051.1.17693 WP_000284051.1.17702 WP_000284051.1.17703 WP_000284051.1.17705 WP_000284051.1.17732 WP_000284051.1.17741 WP_000284051.1.17743 WP_000284051.1.17747 WP_000284051.1.17755 WP_000284051.1.17758 WP_000284051.1.17840 WP_000284051.1.17865 WP_000284051.1.17886 WP_000284051.1.17891 WP_000284051.1.17901 WP_000284051.1.17914 WP_000284051.1.17919 WP_000284051.1.17936 WP_000284051.1.17949 WP_000284051.1.17956 WP_000284051.1.17991 WP_000284051.1.18005 WP_000284051.1.1801 WP_000284051.1.18019 WP_000284051.1.18021 WP_000284051.1.18022 WP_000284051.1.18056 WP_000284051.1.18061 WP_000284051.1.1807 WP_000284051.1.18089 WP_000284051.1.18092 WP_000284051.1.18099 WP_000284051.1.18103 WP_000284051.1.18109 WP_000284051.1.18111 WP_000284051.1.18122 WP_000284051.1.18124 WP_000284051.1.1814 WP_000284051.1.18144 WP_000284051.1.18149 WP_000284051.1.18163 WP_000284051.1.18173 WP_000284051.1.18177 WP_000284051.1.1818 WP_000284051.1.18192 WP_000284051.1.18249 WP_000284051.1.1825 WP_000284051.1.18254 WP_000284051.1.18265 WP_000284051.1.18267 WP_000284051.1.18270 WP_000284051.1.18277 WP_000284051.1.18280 WP_000284051.1.18281 WP_000284051.1.18282 WP_000284051.1.18328 WP_000284051.1.18355 WP_000284051.1.18358 WP_000284051.1.18365 WP_000284051.1.18370 WP_000284051.1.18384 WP_000284051.1.18406 WP_000284051.1.18426 WP_000284051.1.18441 WP_000284051.1.18445 WP_000284051.1.18468 WP_000284051.1.18474 WP_000284051.1.18483 WP_000284051.1.18485 WP_000284051.1.18489 WP_000284051.1.18513 WP_000284051.1.18610 WP_000284051.1.18641 WP_000284051.1.18678 WP_000284051.1.18686 WP_000284051.1.18688 WP_000284051.1.18692 WP_000284051.1.18705 WP_000284051.1.18715 WP_000284051.1.18722 WP_000284051.1.18737 WP_000284051.1.18766 WP_000284051.1.18776 WP_000284051.1.1880 WP_000284051.1.18822 WP_000284051.1.18847 WP_000284051.1.1885 WP_000284051.1.18860 WP_000284051.1.18881 WP_000284051.1.18886 WP_000284051.1.18895 WP_000284051.1.18919 WP_000284051.1.18922 WP_000284051.1.18940 WP_000284051.1.18949 WP_000284051.1.1895 WP_000284051.1.18959 WP_000284051.1.1897 WP_000284051.1.18972 WP_000284051.1.19001 WP_000284051.1.19006 WP_000284051.1.19030 WP_000284051.1.19038 WP_000284051.1.19044 WP_000284051.1.19053 WP_000284051.1.19055 WP_000284051.1.19064 WP_000284051.1.19084 WP_000284051.1.19093 WP_000284051.1.19163 WP_000284051.1.19174 WP_000284051.1.19187 WP_000284051.1.19228 WP_000284051.1.19240 WP_000284051.1.19273 WP_000284051.1.19288 WP_000284051.1.19291 WP_000284051.1.19300 WP_000284051.1.19320 WP_000284051.1.19340 WP_000284051.1.1935 WP_000284051.1.19357 WP_000284051.1.19373 WP_000284051.1.1939 WP_000284051.1.19405 WP_000284051.1.19422 WP_000284051.1.19433 WP_000284051.1.19454 WP_000284051.1.19456 WP_000284051.1.19458 WP_000284051.1.19460 WP_000284051.1.19461 WP_000284051.1.19469 WP_000284051.1.19496 WP_000284051.1.19535 WP_000284051.1.19538 WP_000284051.1.1954 WP_000284051.1.1955 WP_000284051.1.19588 WP_000284051.1.19589 WP_000284051.1.19614 WP_000284051.1.19616 WP_000284051.1.19642 WP_000284051.1.19656 WP_000284051.1.19660 WP_000284051.1.19663 WP_000284051.1.1968 WP_000284051.1.19683 WP_000284051.1.19686 WP_000284051.1.19702 WP_000284051.1.19706 WP_000284051.1.19723 WP_000284051.1.19724 WP_000284051.1.19731 WP_000284051.1.19740 WP_000284051.1.19749 WP_000284051.1.19784 WP_000284051.1.19793 WP_000284051.1.19794 WP_000284051.1.19802 WP_000284051.1.19809 WP_000284051.1.19823 WP_000284051.1.19834 WP_000284051.1.19851 WP_000284051.1.19863 WP_000284051.1.19882 WP_000284051.1.19884 WP_000284051.1.1990 WP_000284051.1.1992 WP_000284051.1.19938 WP_000284051.1.19967 WP_000284051.1.19970 WP_000284051.1.19975 WP_000284051.1.1998 WP_000284051.1.19987 WP_000284051.1.19999 WP_000284051.1.20 WP_000284051.1.20023 WP_000284051.1.20034 WP_000284051.1.20081 WP_000284051.1.20086 WP_000284051.1.20089 WP_000284051.1.20091 WP_000284051.1.2010 WP_000284051.1.20119 WP_000284051.1.20153 WP_000284051.1.20212 WP_000284051.1.20218 WP_000284051.1.20254 WP_000284051.1.20255 WP_000284051.1.2026 WP_000284051.1.20261 WP_000284051.1.20266 WP_000284051.1.20271 WP_000284051.1.20296 WP_000284051.1.20330 WP_000284051.1.20339 WP_000284051.1.20349 WP_000284051.1.2036 WP_000284051.1.20362 WP_000284051.1.20364 WP_000284051.1.20376 WP_000284051.1.20391 WP_000284051.1.2041 WP_000284051.1.20415 WP_000284051.1.20418 WP_000284051.1.20419 WP_000284051.1.20425 WP_000284051.1.20437 WP_000284051.1.20443 WP_000284051.1.20446 WP_000284051.1.20465 WP_000284051.1.2047 WP_000284051.1.20488 WP_000284051.1.20492 WP_000284051.1.20503 WP_000284051.1.20525 WP_000284051.1.2053 WP_000284051.1.2054 WP_000284051.1.20553 WP_000284051.1.20564 WP_000284051.1.20573 WP_000284051.1.20614 WP_000284051.1.20626 WP_000284051.1.20631 WP_000284051.1.20635 WP_000284051.1.20646 WP_000284051.1.20695 WP_000284051.1.20700 WP_000284051.1.20718 WP_000284051.1.20721 WP_000284051.1.2073 WP_000284051.1.20740 WP_000284051.1.20760 WP_000284051.1.20787 WP_000284051.1.20789 WP_000284051.1.20795 WP_000284051.1.20810 WP_000284051.1.20828 WP_000284051.1.20839 WP_000284051.1.20862 WP_000284051.1.2087 WP_000284051.1.20883 WP_000284051.1.20886 WP_000284051.1.20894 WP_000284051.1.20900 WP_000284051.1.20908 WP_000284051.1.2091 WP_000284051.1.20947 WP_000284051.1.20953 WP_000284051.1.2101 WP_000284051.1.21010 WP_000284051.1.21049 WP_000284051.1.2106 WP_000284051.1.21062 WP_000284051.1.2107 WP_000284051.1.21075 WP_000284051.1.21079 WP_000284051.1.21086 WP_000284051.1.21089 WP_000284051.1.21103 WP_000284051.1.21136 WP_000284051.1.21144 WP_000284051.1.21146 WP_000284051.1.2116 WP_000284051.1.21162 WP_000284051.1.21165 WP_000284051.1.21181 WP_000284051.1.21184 WP_000284051.1.21185 WP_000284051.1.21194 WP_000284051.1.21202 WP_000284051.1.21241 WP_000284051.1.21245 WP_000284051.1.21246 WP_000284051.1.21260 WP_000284051.1.21269 WP_000284051.1.21286 WP_000284051.1.2130 WP_000284051.1.21309 WP_000284051.1.21326 WP_000284051.1.21332 WP_000284051.1.21351 WP_000284051.1.21362 WP_000284051.1.21366 WP_000284051.1.2139 WP_000284051.1.21399 WP_000284051.1.21400 WP_000284051.1.21404 WP_000284051.1.21423 WP_000284051.1.21443 WP_000284051.1.21453 WP_000284051.1.2146 WP_000284051.1.21473 WP_000284051.1.21492 WP_000284051.1.21497 WP_000284051.1.21499 WP_000284051.1.21534 WP_000284051.1.21548 WP_000284051.1.21603 WP_000284051.1.2166 WP_000284051.1.21674 WP_000284051.1.21681 WP_000284051.1.21692 WP_000284051.1.21715 WP_000284051.1.21728 WP_000284051.1.21730 WP_000284051.1.21750 WP_000284051.1.21751 WP_000284051.1.21757 WP_000284051.1.21792 WP_000284051.1.21825 WP_000284051.1.21845 WP_000284051.1.21877 WP_000284051.1.21886 WP_000284051.1.21909 WP_000284051.1.21910 WP_000284051.1.21940 WP_000284051.1.21946 WP_000284051.1.21950 WP_000284051.1.21966 WP_000284051.1.21981 WP_000284051.1.21991 WP_000284051.1.22019 WP_000284051.1.22024 WP_000284051.1.22030 WP_000284051.1.2205 WP_000284051.1.22051 WP_000284051.1.22062 WP_000284051.1.22064 WP_000284051.1.22067 WP_000284051.1.22069 WP_000284051.1.22096 WP_000284051.1.22117 WP_000284051.1.22118 WP_000284051.1.22126 WP_000284051.1.22136 WP_000284051.1.22158 WP_000284051.1.2216 WP_000284051.1.22162 WP_000284051.1.22169 WP_000284051.1.22205 WP_000284051.1.22208 WP_000284051.1.2221 WP_000284051.1.22235 WP_000284051.1.2224 WP_000284051.1.22240 WP_000284051.1.2227 WP_000284051.1.22270 WP_000284051.1.22296 WP_000284051.1.22315 WP_000284051.1.22323 WP_000284051.1.22337 WP_000284051.1.22346 WP_000284051.1.2235 WP_000284051.1.22373 WP_000284051.1.22379 WP_000284051.1.22388 WP_000284051.1.22427 WP_000284051.1.22449 WP_000284051.1.22451 WP_000284051.1.22453 WP_000284051.1.22454 WP_000284051.1.2246 WP_000284051.1.22460 WP_000284051.1.22476 WP_000284051.1.22485 WP_000284051.1.22514 WP_000284051.1.22537 WP_000284051.1.22565 WP_000284051.1.22566 WP_000284051.1.22575 WP_000284051.1.22582 WP_000284051.1.22595 WP_000284051.1.22604 WP_000284051.1.22605 WP_000284051.1.22614 WP_000284051.1.22620 WP_000284051.1.22623 WP_000284051.1.22645 WP_000284051.1.22652 WP_000284051.1.22676 WP_000284051.1.22683 WP_000284051.1.22692 WP_000284051.1.22758 WP_000284051.1.22760 WP_000284051.1.2283 WP_000284051.1.2284 WP_000284051.1.22845 WP_000284051.1.22855 WP_000284051.1.22857 WP_000284051.1.22864 WP_000284051.1.22870 WP_000284051.1.22880 WP_000284051.1.22895 WP_000284051.1.22902 WP_000284051.1.22926 WP_000284051.1.22943 WP_000284051.1.22947 WP_000284051.1.22966 WP_000284051.1.22967 WP_000284051.1.22979 WP_000284051.1.23010 WP_000284051.1.23040 WP_000284051.1.23041 WP_000284051.1.23053 WP_000284051.1.23058 WP_000284051.1.23080 WP_000284051.1.23102 WP_000284051.1.23114 WP_000284051.1.2314 WP_000284051.1.23148 WP_000284051.1.23155 WP_000284051.1.23169 WP_000284051.1.23172 WP_000284051.1.23175 WP_000284051.1.23192 WP_000284051.1.23201 WP_000284051.1.23218 WP_000284051.1.23219 WP_000284051.1.2324 WP_000284051.1.23246 WP_000284051.1.23258 WP_000284051.1.23259 WP_000284051.1.23274 WP_000284051.1.23279 WP_000284051.1.23309 WP_000284051.1.2331 WP_000284051.1.23311 WP_000284051.1.2332 WP_000284051.1.23329 WP_000284051.1.23340 WP_000284051.1.23341 WP_000284051.1.23343 WP_000284051.1.2336 WP_000284051.1.23365 WP_000284051.1.23379 WP_000284051.1.23409 WP_000284051.1.23412 WP_000284051.1.2342 WP_000284051.1.23426 WP_000284051.1.2343 WP_000284051.1.23442 WP_000284051.1.23444 WP_000284051.1.23460 WP_000284051.1.23466 WP_000284051.1.23472 WP_000284051.1.23482 WP_000284051.1.23485 WP_000284051.1.23492 WP_000284051.1.235 WP_000284051.1.23500 WP_000284051.1.23503 WP_000284051.1.23509 WP_000284051.1.23513 WP_000284051.1.23515 WP_000284051.1.23529 WP_000284051.1.23548 WP_000284051.1.23571 WP_000284051.1.2358 WP_000284051.1.23587 WP_000284051.1.23604 WP_000284051.1.23621 WP_000284051.1.23629 WP_000284051.1.23631 WP_000284051.1.23634 WP_000284051.1.23639 WP_000284051.1.2364 WP_000284051.1.23643 WP_000284051.1.23646 WP_000284051.1.23670 WP_000284051.1.23675 WP_000284051.1.23679 WP_000284051.1.23685 WP_000284051.1.237 WP_000284051.1.23707 WP_000284051.1.23720 WP_000284051.1.23728 WP_000284051.1.23736 WP_000284051.1.23746 WP_000284051.1.2375 WP_000284051.1.23755 WP_000284051.1.2376 WP_000284051.1.23783 WP_000284051.1.23786 WP_000284051.1.23787 WP_000284051.1.2380 WP_000284051.1.23801 WP_000284051.1.23819 WP_000284051.1.23932 WP_000284051.1.23959 WP_000284051.1.24017 WP_000284051.1.24028 WP_000284051.1.24061 WP_000284051.1.24082 WP_000284051.1.24083 WP_000284051.1.24117 WP_000284051.1.24125 WP_000284051.1.24138 WP_000284051.1.24145 WP_000284051.1.24153 WP_000284051.1.24158 WP_000284051.1.24163 WP_000284051.1.24206 WP_000284051.1.24214 WP_000284051.1.24250 WP_000284051.1.24259 WP_000284051.1.24291 WP_000284051.1.24297 WP_000284051.1.24303 WP_000284051.1.24308 WP_000284051.1.24322 WP_000284051.1.24325 WP_000284051.1.24355 WP_000284051.1.24361 WP_000284051.1.24375 WP_000284051.1.24376 WP_000284051.1.24392 WP_000284051.1.24394 WP_000284051.1.24400 WP_000284051.1.24408 WP_000284051.1.24409 WP_000284051.1.24412 WP_000284051.1.24420 WP_000284051.1.24433 WP_000284051.1.24444 WP_000284051.1.24450 WP_000284051.1.24494 WP_000284051.1.24521 WP_000284051.1.24555 WP_000284051.1.24567 WP_000284051.1.24578 WP_000284051.1.24619 WP_000284051.1.24643 WP_000284051.1.2467 WP_000284051.1.24673 WP_000284051.1.24686 WP_000284051.1.24688 WP_000284051.1.24689 WP_000284051.1.24696 WP_000284051.1.24716 WP_000284051.1.24723 WP_000284051.1.24727 WP_000284051.1.24737 WP_000284051.1.24779 WP_000284051.1.2481 WP_000284051.1.24832 WP_000284051.1.24837 WP_000284051.1.24839 WP_000284051.1.24873 WP_000284051.1.24901 WP_000284051.1.24944 WP_000284051.1.24964 WP_000284051.1.24995 WP_000284051.1.25008 WP_000284051.1.25015 WP_000284051.1.25017 WP_000284051.1.25032 WP_000284051.1.25036 WP_000284051.1.25041 WP_000284051.1.25053 WP_000284051.1.25064 WP_000284051.1.25072 WP_000284051.1.25119 WP_000284051.1.25130 WP_000284051.1.25140 WP_000284051.1.25159 WP_000284051.1.25175 WP_000284051.1.25185 WP_000284051.1.25196 WP_000284051.1.25205 WP_000284051.1.25206 WP_000284051.1.25210 WP_000284051.1.25217 WP_000284051.1.25219 WP_000284051.1.25229 WP_000284051.1.2525 WP_000284051.1.25297 WP_000284051.1.25304 WP_000284051.1.25354 WP_000284051.1.25374 WP_000284051.1.25397 WP_000284051.1.25405 WP_000284051.1.25426 WP_000284051.1.25454 WP_000284051.1.25475 WP_000284051.1.25490 WP_000284051.1.25493 WP_000284051.1.25498 WP_000284051.1.25508 WP_000284051.1.25512 WP_000284051.1.25514 WP_000284051.1.2554 WP_000284051.1.25546 WP_000284051.1.25564 WP_000284051.1.25596 WP_000284051.1.25603 WP_000284051.1.25607 WP_000284051.1.25618 WP_000284051.1.2562 WP_000284051.1.25666 WP_000284051.1.25668 WP_000284051.1.25690 WP_000284051.1.25692 WP_000284051.1.2570 WP_000284051.1.25700 WP_000284051.1.25703 WP_000284051.1.25708 WP_000284051.1.25722 WP_000284051.1.25740 WP_000284051.1.25780 WP_000284051.1.25793 WP_000284051.1.25807 WP_000284051.1.25809 WP_000284051.1.2581 WP_000284051.1.25814 WP_000284051.1.25821 WP_000284051.1.25825 WP_000284051.1.25833 WP_000284051.1.25835 WP_000284051.1.25846 WP_000284051.1.25882 WP_000284051.1.25911 WP_000284051.1.25928 WP_000284051.1.25932 WP_000284051.1.25951 WP_000284051.1.25962 WP_000284051.1.25963 WP_000284051.1.25988 WP_000284051.1.26001 WP_000284051.1.26027 WP_000284051.1.26030 WP_000284051.1.26034 WP_000284051.1.26075 WP_000284051.1.26083 WP_000284051.1.26093 WP_000284051.1.26107 WP_000284051.1.26122 WP_000284051.1.26123 WP_000284051.1.26129 WP_000284051.1.2615 WP_000284051.1.26194 WP_000284051.1.26199 WP_000284051.1.26213 WP_000284051.1.26217 WP_000284051.1.26224 WP_000284051.1.26230 WP_000284051.1.26232 WP_000284051.1.26269 WP_000284051.1.26272 WP_000284051.1.26282 WP_000284051.1.26286 WP_000284051.1.26288 WP_000284051.1.26311 WP_000284051.1.26319 WP_000284051.1.2634 WP_000284051.1.26363 WP_000284051.1.26384 WP_000284051.1.26394 WP_000284051.1.26426 WP_000284051.1.26429 WP_000284051.1.26440 WP_000284051.1.26441 WP_000284051.1.26491 WP_000284051.1.26493 WP_000284051.1.26512 WP_000284051.1.2654 WP_000284051.1.26551 WP_000284051.1.26554 WP_000284051.1.26563 WP_000284051.1.26567 WP_000284051.1.26576 WP_000284051.1.26582 WP_000284051.1.2660 WP_000284051.1.26636 WP_000284051.1.26646 WP_000284051.1.2667 WP_000284051.1.26687 WP_000284051.1.26689 WP_000284051.1.26709 WP_000284051.1.2672 WP_000284051.1.26741 WP_000284051.1.26750 WP_000284051.1.26758 WP_000284051.1.26787 WP_000284051.1.2679 WP_000284051.1.26794 WP_000284051.1.26833 WP_000284051.1.26856 WP_000284051.1.26882 WP_000284051.1.26883 WP_000284051.1.26892 WP_000284051.1.26908 WP_000284051.1.26919 WP_000284051.1.2692 WP_000284051.1.26924 WP_000284051.1.26928 WP_000284051.1.26936 WP_000284051.1.26980 WP_000284051.1.270 WP_000284051.1.27008 WP_000284051.1.27010 WP_000284051.1.27027 WP_000284051.1.27051 WP_000284051.1.27055 WP_000284051.1.27070 WP_000284051.1.27072 WP_000284051.1.27077 WP_000284051.1.27084 WP_000284051.1.27086 WP_000284051.1.27087 WP_000284051.1.27111 WP_000284051.1.27115 WP_000284051.1.27122 WP_000284051.1.2713 WP_000284051.1.27142 WP_000284051.1.27169 WP_000284051.1.2717 WP_000284051.1.27173 WP_000284051.1.272 WP_000284051.1.27206 WP_000284051.1.27223 WP_000284051.1.27228 WP_000284051.1.2723 WP_000284051.1.27255 WP_000284051.1.27272 WP_000284051.1.27279 WP_000284051.1.27282 WP_000284051.1.27285 WP_000284051.1.27309 WP_000284051.1.27314 WP_000284051.1.27329 WP_000284051.1.27342 WP_000284051.1.27361 WP_000284051.1.27383 WP_000284051.1.27419 WP_000284051.1.27423 WP_000284051.1.27452 WP_000284051.1.27513 WP_000284051.1.27522 WP_000284051.1.27523 WP_000284051.1.27535 WP_000284051.1.27544 WP_000284051.1.27547 WP_000284051.1.27556 WP_000284051.1.27561 WP_000284051.1.27565 WP_000284051.1.27595 WP_000284051.1.27598 WP_000284051.1.27616 WP_000284051.1.2763 WP_000284051.1.27632 WP_000284051.1.27638 WP_000284051.1.27655 WP_000284051.1.27658 WP_000284051.1.27665 WP_000284051.1.27679 WP_000284051.1.27706 WP_000284051.1.27707 WP_000284051.1.27713 WP_000284051.1.27755 WP_000284051.1.27761 WP_000284051.1.2777 WP_000284051.1.27775 WP_000284051.1.27776 WP_000284051.1.27785 WP_000284051.1.27798 WP_000284051.1.27800 WP_000284051.1.27815 WP_000284051.1.27833 WP_000284051.1.27857 WP_000284051.1.27883 WP_000284051.1.27892 WP_000284051.1.27900 WP_000284051.1.27928 WP_000284051.1.27945 WP_000284051.1.27969 WP_000284051.1.27977 WP_000284051.1.27995 WP_000284051.1.27997 WP_000284051.1.28002 WP_000284051.1.28004 WP_000284051.1.28032 WP_000284051.1.28037 WP_000284051.1.28056 WP_000284051.1.2806 WP_000284051.1.28073 WP_000284051.1.2809 WP_000284051.1.28094 WP_000284051.1.28116 WP_000284051.1.28126 WP_000284051.1.28139 WP_000284051.1.28155 WP_000284051.1.28170 WP_000284051.1.28174 WP_000284051.1.28198 WP_000284051.1.28200 WP_000284051.1.2822 WP_000284051.1.28225 WP_000284051.1.28229 WP_000284051.1.28232 WP_000284051.1.28233 WP_000284051.1.28235 WP_000284051.1.2825 WP_000284051.1.28267 WP_000284051.1.2829 WP_000284051.1.28301 WP_000284051.1.28302 WP_000284051.1.28303 WP_000284051.1.2835 WP_000284051.1.28370 WP_000284051.1.28384 WP_000284051.1.28386 WP_000284051.1.28393 WP_000284051.1.28395 WP_000284051.1.284 WP_000284051.1.2845 WP_000284051.1.28462 WP_000284051.1.28479 WP_000284051.1.28504 WP_000284051.1.28512 WP_000284051.1.28514 WP_000284051.1.2853 WP_000284051.1.28538 WP_000284051.1.28570 WP_000284051.1.28575 WP_000284051.1.28612 WP_000284051.1.28620 WP_000284051.1.28625 WP_000284051.1.28627 WP_000284051.1.28655 WP_000284051.1.28665 WP_000284051.1.28673 WP_000284051.1.28692 WP_000284051.1.28694 WP_000284051.1.287 WP_000284051.1.2873 WP_000284051.1.28733 WP_000284051.1.28773 WP_000284051.1.28775 WP_000284051.1.28776 WP_000284051.1.2879 WP_000284051.1.28811 WP_000284051.1.28830 WP_000284051.1.2890 WP_000284051.1.28902 WP_000284051.1.28917 WP_000284051.1.28921 WP_000284051.1.28938 WP_000284051.1.28946 WP_000284051.1.28948 WP_000284051.1.28962 WP_000284051.1.28963 WP_000284051.1.28977 WP_000284051.1.29006 WP_000284051.1.29010 WP_000284051.1.29023 WP_000284051.1.29042 WP_000284051.1.2905 WP_000284051.1.2907 WP_000284051.1.29081 WP_000284051.1.29089 WP_000284051.1.29099 WP_000284051.1.2910 WP_000284051.1.29113 WP_000284051.1.29130 WP_000284051.1.2915 WP_000284051.1.29153 WP_000284051.1.29168 WP_000284051.1.29174 WP_000284051.1.29190 WP_000284051.1.29203 WP_000284051.1.29218 WP_000284051.1.29237 WP_000284051.1.2924 WP_000284051.1.29248 WP_000284051.1.29255 WP_000284051.1.29265 WP_000284051.1.29288 WP_000284051.1.2932 WP_000284051.1.29349 WP_000284051.1.29379 WP_000284051.1.29389 WP_000284051.1.29422 WP_000284051.1.29436 WP_000284051.1.29439 WP_000284051.1.29454 WP_000284051.1.2946 WP_000284051.1.29462 WP_000284051.1.29509 WP_000284051.1.29530 WP_000284051.1.29563 WP_000284051.1.29588 WP_000284051.1.29593 WP_000284051.1.29601 WP_000284051.1.29606 WP_000284051.1.29615 WP_000284051.1.29619 WP_000284051.1.29682 WP_000284051.1.29704 WP_000284051.1.29711 WP_000284051.1.29727 WP_000284051.1.29732 WP_000284051.1.29743 WP_000284051.1.29768 WP_000284051.1.29774 WP_000284051.1.29775 WP_000284051.1.29782 WP_000284051.1.29827 WP_000284051.1.29833 WP_000284051.1.2984 WP_000284051.1.29845 WP_000284051.1.29851 WP_000284051.1.29865 WP_000284051.1.29886 WP_000284051.1.29898 WP_000284051.1.29919 WP_000284051.1.29923 WP_000284051.1.29924 WP_000284051.1.2994 WP_000284051.1.29964 WP_000284051.1.29969 WP_000284051.1.29983 WP_000284051.1.29990 WP_000284051.1.30006 WP_000284051.1.30009 WP_000284051.1.30013 WP_000284051.1.30018 WP_000284051.1.3002 WP_000284051.1.30022 WP_000284051.1.30027 WP_000284051.1.30034 WP_000284051.1.30049 WP_000284051.1.3005 WP_000284051.1.30058 WP_000284051.1.30059 WP_000284051.1.30086 WP_000284051.1.30093 WP_000284051.1.30165 WP_000284051.1.3017 WP_000284051.1.30170 WP_000284051.1.30179 WP_000284051.1.30180 WP_000284051.1.30185 WP_000284051.1.30195 WP_000284051.1.30202 WP_000284051.1.30210 WP_000284051.1.30213 WP_000284051.1.30225 WP_000284051.1.30238 WP_000284051.1.30246 WP_000284051.1.30278 WP_000284051.1.30331 WP_000284051.1.30354 WP_000284051.1.30356 WP_000284051.1.30357 WP_000284051.1.30362 WP_000284051.1.30386 WP_000284051.1.30389 WP_000284051.1.3042 WP_000284051.1.30421 WP_000284051.1.30425 WP_000284051.1.30437 WP_000284051.1.30440 WP_000284051.1.30448 WP_000284051.1.30469 WP_000284051.1.30489 WP_000284051.1.30492 WP_000284051.1.30505 WP_000284051.1.30507 WP_000284051.1.30517 WP_000284051.1.30535 WP_000284051.1.30542 WP_000284051.1.30544 WP_000284051.1.30547 WP_000284051.1.30548 WP_000284051.1.30555 WP_000284051.1.30556 WP_000284051.1.30572 WP_000284051.1.30573 WP_000284051.1.30585 WP_000284051.1.30589 WP_000284051.1.30602 WP_000284051.1.30618 WP_000284051.1.30619 WP_000284051.1.30627 WP_000284051.1.30635 WP_000284051.1.3066 WP_000284051.1.30664 WP_000284051.1.3068 WP_000284051.1.30688 WP_000284051.1.30696 WP_000284051.1.30752 WP_000284051.1.3076 WP_000284051.1.30794 WP_000284051.1.3080 WP_000284051.1.30802 WP_000284051.1.30803 WP_000284051.1.30819 WP_000284051.1.30823 WP_000284051.1.30833 WP_000284051.1.30835 WP_000284051.1.3089 WP_000284051.1.30909 WP_000284051.1.30934 WP_000284051.1.3095 WP_000284051.1.30951 WP_000284051.1.30967 WP_000284051.1.30968 WP_000284051.1.30972 WP_000284051.1.31 WP_000284051.1.31001 WP_000284051.1.31011 WP_000284051.1.31042 WP_000284051.1.31046 WP_000284051.1.31066 WP_000284051.1.31069 WP_000284051.1.31078 WP_000284051.1.31086 WP_000284051.1.31092 WP_000284051.1.31107 WP_000284051.1.31111 WP_000284051.1.31122 WP_000284051.1.3113 WP_000284051.1.31139 WP_000284051.1.3114 WP_000284051.1.31145 WP_000284051.1.31156 WP_000284051.1.31167 WP_000284051.1.31171 WP_000284051.1.31182 WP_000284051.1.31185 WP_000284051.1.3119 WP_000284051.1.31190 WP_000284051.1.31195 WP_000284051.1.31196 WP_000284051.1.31198 WP_000284051.1.31205 WP_000284051.1.3121 WP_000284051.1.31210 WP_000284051.1.31214 WP_000284051.1.31219 WP_000284051.1.31222 WP_000284051.1.31223 WP_000284051.1.3124 WP_000284051.1.31240 WP_000284051.1.31251 WP_000284051.1.31262 WP_000284051.1.3127 WP_000284051.1.31272 WP_000284051.1.31281 WP_000284051.1.31303 WP_000284051.1.3131 WP_000284051.1.31335 WP_000284051.1.31352 WP_000284051.1.31362 WP_000284051.1.31389 WP_000284051.1.31413 WP_000284051.1.31435 WP_000284051.1.31446 WP_000284051.1.31451 WP_000284051.1.31476 WP_000284051.1.31504 WP_000284051.1.31515 WP_000284051.1.31533 WP_000284051.1.31546 WP_000284051.1.31578 WP_000284051.1.31585 WP_000284051.1.31590 WP_000284051.1.31658 WP_000284051.1.31665 WP_000284051.1.3167 WP_000284051.1.3170 WP_000284051.1.31720 WP_000284051.1.31725 WP_000284051.1.31762 WP_000284051.1.31782 WP_000284051.1.31799 WP_000284051.1.31836 WP_000284051.1.31845 WP_000284051.1.3185 WP_000284051.1.31854 WP_000284051.1.31895 WP_000284051.1.31901 WP_000284051.1.31927 WP_000284051.1.31940 WP_000284051.1.31951 WP_000284051.1.31952 WP_000284051.1.31967 WP_000284051.1.31972 WP_000284051.1.32006 WP_000284051.1.32038 WP_000284051.1.32041 WP_000284051.1.32042 WP_000284051.1.32054 WP_000284051.1.32056 WP_000284051.1.3207 WP_000284051.1.3208 WP_000284051.1.32109 WP_000284051.1.32116 WP_000284051.1.32170 WP_000284051.1.32189 WP_000284051.1.32192 WP_000284051.1.32202 WP_000284051.1.32204 WP_000284051.1.32206 WP_000284051.1.32252 WP_000284051.1.32255 WP_000284051.1.32260 WP_000284051.1.32263 WP_000284051.1.32274 WP_000284051.1.32275 WP_000284051.1.32277 WP_000284051.1.32293 WP_000284051.1.32299 WP_000284051.1.32309 WP_000284051.1.32357 WP_000284051.1.32368 WP_000284051.1.32408 WP_000284051.1.32422 WP_000284051.1.32423 WP_000284051.1.32424 WP_000284051.1.32425 WP_000284051.1.32434 WP_000284051.1.32438 WP_000284051.1.32458 WP_000284051.1.32459 WP_000284051.1.32460 WP_000284051.1.32491 WP_000284051.1.32493 WP_000284051.1.32515 WP_000284051.1.32519 WP_000284051.1.32527 WP_000284051.1.32529 WP_000284051.1.32545 WP_000284051.1.32563 WP_000284051.1.32578 WP_000284051.1.32617 WP_000284051.1.32624 WP_000284051.1.32629 WP_000284051.1.32643 WP_000284051.1.32660 WP_000284051.1.32668 WP_000284051.1.3270 WP_000284051.1.32702 WP_000284051.1.32714 WP_000284051.1.32725 WP_000284051.1.32740 WP_000284051.1.32747 WP_000284051.1.32750 WP_000284051.1.3278 WP_000284051.1.32786 WP_000284051.1.32804 WP_000284051.1.32832 WP_000284051.1.32838 WP_000284051.1.32848 WP_000284051.1.32860 WP_000284051.1.32868 WP_000284051.1.32881 WP_000284051.1.32899 WP_000284051.1.329 WP_000284051.1.3290 WP_000284051.1.32900 WP_000284051.1.32902 WP_000284051.1.32907 WP_000284051.1.32930 WP_000284051.1.32940 WP_000284051.1.32941 WP_000284051.1.3296 WP_000284051.1.32961 WP_000284051.1.32966 WP_000284051.1.32977 WP_000284051.1.32985 WP_000284051.1.33010 WP_000284051.1.33030 WP_000284051.1.33037 WP_000284051.1.3304 WP_000284051.1.3305 WP_000284051.1.33050 WP_000284051.1.33051 WP_000284051.1.33065 WP_000284051.1.33068 WP_000284051.1.33078 WP_000284051.1.3310 WP_000284051.1.33106 WP_000284051.1.33114 WP_000284051.1.33122 WP_000284051.1.33127 WP_000284051.1.33134 WP_000284051.1.33143 WP_000284051.1.33144 WP_000284051.1.3315 WP_000284051.1.33160 WP_000284051.1.33208 WP_000284051.1.33214 WP_000284051.1.33247 WP_000284051.1.33248 WP_000284051.1.33253 WP_000284051.1.33261 WP_000284051.1.33270 WP_000284051.1.33280 WP_000284051.1.33283 WP_000284051.1.333 WP_000284051.1.33313 WP_000284051.1.33339 WP_000284051.1.33343 WP_000284051.1.33382 WP_000284051.1.33392 WP_000284051.1.33409 WP_000284051.1.33420 WP_000284051.1.33486 WP_000284051.1.33490 WP_000284051.1.33499 WP_000284051.1.335 WP_000284051.1.33501 WP_000284051.1.33504 WP_000284051.1.33529 WP_000284051.1.33553 WP_000284051.1.3356 WP_000284051.1.33580 WP_000284051.1.33586 WP_000284051.1.33592 WP_000284051.1.33609 WP_000284051.1.33629 WP_000284051.1.3364 WP_000284051.1.33659 WP_000284051.1.33689 WP_000284051.1.33693 WP_000284051.1.3370 WP_000284051.1.33730 WP_000284051.1.33741 WP_000284051.1.33786 WP_000284051.1.33817 WP_000284051.1.33825 WP_000284051.1.33840 WP_000284051.1.33870 WP_000284051.1.33894 WP_000284051.1.3392 WP_000284051.1.33926 WP_000284051.1.3394 WP_000284051.1.3395 WP_000284051.1.33957 WP_000284051.1.3396 WP_000284051.1.33969 WP_000284051.1.33986 WP_000284051.1.34001 WP_000284051.1.34022 WP_000284051.1.34043 WP_000284051.1.34059 WP_000284051.1.34075 WP_000284051.1.34081 WP_000284051.1.34084 WP_000284051.1.34091 WP_000284051.1.34107 WP_000284051.1.34118 WP_000284051.1.34126 WP_000284051.1.34184 WP_000284051.1.34185 WP_000284051.1.34211 WP_000284051.1.34214 WP_000284051.1.34234 WP_000284051.1.34257 WP_000284051.1.34259 WP_000284051.1.34279 WP_000284051.1.34284 WP_000284051.1.34292 WP_000284051.1.34304 WP_000284051.1.34319 WP_000284051.1.34330 WP_000284051.1.34364 WP_000284051.1.34376 WP_000284051.1.3438 WP_000284051.1.34382 WP_000284051.1.34417 WP_000284051.1.34424 WP_000284051.1.34431 WP_000284051.1.3445 WP_000284051.1.34453 WP_000284051.1.34454 WP_000284051.1.34458 WP_000284051.1.34484 WP_000284051.1.34496 WP_000284051.1.345 WP_000284051.1.34517 WP_000284051.1.34530 WP_000284051.1.34539 WP_000284051.1.34610 WP_000284051.1.34614 WP_000284051.1.34647 WP_000284051.1.34659 WP_000284051.1.34665 WP_000284051.1.34667 WP_000284051.1.34694 WP_000284051.1.34703 WP_000284051.1.34704 WP_000284051.1.34707 WP_000284051.1.34711 WP_000284051.1.34745 WP_000284051.1.34751 WP_000284051.1.3476 WP_000284051.1.34808 WP_000284051.1.34817 WP_000284051.1.34820 WP_000284051.1.34824 WP_000284051.1.34834 WP_000284051.1.34854 WP_000284051.1.34856 WP_000284051.1.34881 WP_000284051.1.3489 WP_000284051.1.34907 WP_000284051.1.34932 WP_000284051.1.34962 WP_000284051.1.34972 WP_000284051.1.34975 WP_000284051.1.34977 WP_000284051.1.35001 WP_000284051.1.35035 WP_000284051.1.35040 WP_000284051.1.35045 WP_000284051.1.35074 WP_000284051.1.35075 WP_000284051.1.35125 WP_000284051.1.35129 WP_000284051.1.35175 WP_000284051.1.35184 WP_000284051.1.35193 WP_000284051.1.35219 WP_000284051.1.35240 WP_000284051.1.35274 WP_000284051.1.35294 WP_000284051.1.35298 WP_000284051.1.35321 WP_000284051.1.35331 WP_000284051.1.35371 WP_000284051.1.35404 WP_000284051.1.35408 WP_000284051.1.3541 WP_000284051.1.35425 WP_000284051.1.35429 WP_000284051.1.35446 WP_000284051.1.35460 WP_000284051.1.35463 WP_000284051.1.35494 WP_000284051.1.35503 WP_000284051.1.35507 WP_000284051.1.35509 WP_000284051.1.35532 WP_000284051.1.3556 WP_000284051.1.35560 WP_000284051.1.35563 WP_000284051.1.3557 WP_000284051.1.35570 WP_000284051.1.35575 WP_000284051.1.35590 WP_000284051.1.35594 WP_000284051.1.35624 WP_000284051.1.35628 WP_000284051.1.35648 WP_000284051.1.3566 WP_000284051.1.3570 WP_000284051.1.35712 WP_000284051.1.35713 WP_000284051.1.35736 WP_000284051.1.35777 WP_000284051.1.35791 WP_000284051.1.35795 WP_000284051.1.35809 WP_000284051.1.35835 WP_000284051.1.35847 WP_000284051.1.35868 WP_000284051.1.35870 WP_000284051.1.35887 WP_000284051.1.35892 WP_000284051.1.35916 WP_000284051.1.35936 WP_000284051.1.35938 WP_000284051.1.35940 WP_000284051.1.35961 WP_000284051.1.35966 WP_000284051.1.35993 WP_000284051.1.36000 WP_000284051.1.36003 WP_000284051.1.3601 WP_000284051.1.36011 WP_000284051.1.36017 WP_000284051.1.36034 WP_000284051.1.36036 WP_000284051.1.36037 WP_000284051.1.36057 WP_000284051.1.36063 WP_000284051.1.36069 WP_000284051.1.3610 WP_000284051.1.36157 WP_000284051.1.36172 WP_000284051.1.36229 WP_000284051.1.36232 WP_000284051.1.36236 WP_000284051.1.36286 WP_000284051.1.36291 WP_000284051.1.36298 WP_000284051.1.36308 WP_000284051.1.36323 WP_000284051.1.36343 WP_000284051.1.36409 WP_000284051.1.36425 WP_000284051.1.36445 WP_000284051.1.36460 WP_000284051.1.3649 WP_000284051.1.36495 WP_000284051.1.36512 WP_000284051.1.36526 WP_000284051.1.36542 WP_000284051.1.36547 WP_000284051.1.36564 WP_000284051.1.36567 WP_000284051.1.36579 WP_000284051.1.36584 WP_000284051.1.36586 WP_000284051.1.36592 WP_000284051.1.36609 WP_000284051.1.36617 WP_000284051.1.36618 WP_000284051.1.36643 WP_000284051.1.36652 WP_000284051.1.36663 WP_000284051.1.36685 WP_000284051.1.36690 WP_000284051.1.3670 WP_000284051.1.36701 WP_000284051.1.36705 WP_000284051.1.36721 WP_000284051.1.36725 WP_000284051.1.36751 WP_000284051.1.36764 WP_000284051.1.36765 WP_000284051.1.36779 WP_000284051.1.36792 WP_000284051.1.36798 WP_000284051.1.36802 WP_000284051.1.36821 WP_000284051.1.36839 WP_000284051.1.36853 WP_000284051.1.36875 WP_000284051.1.3688 WP_000284051.1.36885 WP_000284051.1.36889 WP_000284051.1.36899 WP_000284051.1.36918 WP_000284051.1.36931 WP_000284051.1.36948 WP_000284051.1.36949 WP_000284051.1.36950 WP_000284051.1.36978 WP_000284051.1.37013 WP_000284051.1.37014 WP_000284051.1.37021 WP_000284051.1.37028 WP_000284051.1.37029 WP_000284051.1.37063 WP_000284051.1.37073 WP_000284051.1.37100 WP_000284051.1.37111 WP_000284051.1.37112 WP_000284051.1.37114 WP_000284051.1.37119 WP_000284051.1.37133 WP_000284051.1.37147 WP_000284051.1.37158 WP_000284051.1.37176 WP_000284051.1.37190 WP_000284051.1.37191 WP_000284051.1.37199 WP_000284051.1.37200 WP_000284051.1.37256 WP_000284051.1.37258 WP_000284051.1.37267 WP_000284051.1.3728 WP_000284051.1.37293 WP_000284051.1.37297 WP_000284051.1.37303 WP_000284051.1.37320 WP_000284051.1.3734 WP_000284051.1.37351 WP_000284051.1.37363 WP_000284051.1.37376 WP_000284051.1.37405 WP_000284051.1.3741 WP_000284051.1.3744 WP_000284051.1.37478 WP_000284051.1.3748 WP_000284051.1.37498 WP_000284051.1.37504 WP_000284051.1.3751 WP_000284051.1.37513 WP_000284051.1.37521 WP_000284051.1.37558 WP_000284051.1.3756 WP_000284051.1.37584 WP_000284051.1.37590 WP_000284051.1.37593 WP_000284051.1.37600 WP_000284051.1.37610 WP_000284051.1.37613 WP_000284051.1.37618 WP_000284051.1.37659 WP_000284051.1.37662 WP_000284051.1.37666 WP_000284051.1.37675 WP_000284051.1.37687 WP_000284051.1.37691 WP_000284051.1.3771 WP_000284051.1.37719 WP_000284051.1.37761 WP_000284051.1.37775 WP_000284051.1.37777 WP_000284051.1.3778 WP_000284051.1.378 WP_000284051.1.37808 WP_000284051.1.37848 WP_000284051.1.37864 WP_000284051.1.379 WP_000284051.1.3790 WP_000284051.1.37911 WP_000284051.1.37941 WP_000284051.1.37965 WP_000284051.1.37968 WP_000284051.1.37978 WP_000284051.1.37985 WP_000284051.1.38001 WP_000284051.1.38026 WP_000284051.1.38037 WP_000284051.1.38047 WP_000284051.1.38055 WP_000284051.1.38061 WP_000284051.1.38064 WP_000284051.1.38108 WP_000284051.1.38113 WP_000284051.1.38125 WP_000284051.1.38145 WP_000284051.1.3816 WP_000284051.1.38199 WP_000284051.1.38207 WP_000284051.1.38261 WP_000284051.1.38266 WP_000284051.1.38273 WP_000284051.1.3828 WP_000284051.1.383 WP_000284051.1.38310 WP_000284051.1.38322 WP_000284051.1.3834 WP_000284051.1.38341 WP_000284051.1.38344 WP_000284051.1.38349 WP_000284051.1.38351 WP_000284051.1.3838 WP_000284051.1.38381 WP_000284051.1.38393 WP_000284051.1.38404 WP_000284051.1.38408 WP_000284051.1.38440 WP_000284051.1.38452 WP_000284051.1.3848 WP_000284051.1.38486 WP_000284051.1.38512 WP_000284051.1.38515 WP_000284051.1.38569 WP_000284051.1.38595 WP_000284051.1.3860 WP_000284051.1.38609 WP_000284051.1.38613 WP_000284051.1.38620 WP_000284051.1.38622 WP_000284051.1.38642 WP_000284051.1.38673 WP_000284051.1.3869 WP_000284051.1.38693 WP_000284051.1.38734 WP_000284051.1.38740 WP_000284051.1.38773 WP_000284051.1.38781 WP_000284051.1.38797 WP_000284051.1.38830 WP_000284051.1.38857 WP_000284051.1.38877 WP_000284051.1.38881 WP_000284051.1.38882 WP_000284051.1.38886 WP_000284051.1.38895 WP_000284051.1.38898 WP_000284051.1.3891 WP_000284051.1.38913 WP_000284051.1.38983 WP_000284051.1.38995 WP_000284051.1.38996 WP_000284051.1.39003 WP_000284051.1.39038 WP_000284051.1.39048 WP_000284051.1.39055 WP_000284051.1.39056 WP_000284051.1.39059 WP_000284051.1.39065 WP_000284051.1.3907 WP_000284051.1.39082 WP_000284051.1.39105 WP_000284051.1.39112 WP_000284051.1.39113 WP_000284051.1.39128 WP_000284051.1.39136 WP_000284051.1.3914 WP_000284051.1.39140 WP_000284051.1.39147 WP_000284051.1.39161 WP_000284051.1.39183 WP_000284051.1.39197 WP_000284051.1.39210 WP_000284051.1.39229 WP_000284051.1.39235 WP_000284051.1.39265 WP_000284051.1.39275 WP_000284051.1.3931 WP_000284051.1.39311 WP_000284051.1.39312 WP_000284051.1.39385 WP_000284051.1.39395 WP_000284051.1.39405 WP_000284051.1.39420 WP_000284051.1.39435 WP_000284051.1.39449 WP_000284051.1.39466 WP_000284051.1.39471 WP_000284051.1.39484 WP_000284051.1.39497 WP_000284051.1.39502 WP_000284051.1.39503 WP_000284051.1.39512 WP_000284051.1.39530 WP_000284051.1.39553 WP_000284051.1.39556 WP_000284051.1.39576 WP_000284051.1.39584 WP_000284051.1.39609 WP_000284051.1.39619 WP_000284051.1.39620 WP_000284051.1.39624 WP_000284051.1.39629 WP_000284051.1.39632 WP_000284051.1.39659 WP_000284051.1.39667 WP_000284051.1.39722 WP_000284051.1.39723 WP_000284051.1.39724 WP_000284051.1.39763 WP_000284051.1.39775 WP_000284051.1.39808 WP_000284051.1.39862 WP_000284051.1.39879 WP_000284051.1.39890 WP_000284051.1.39921 WP_000284051.1.39923 WP_000284051.1.39941 WP_000284051.1.39945 WP_000284051.1.39947 WP_000284051.1.39953 WP_000284051.1.40008 WP_000284051.1.40017 WP_000284051.1.40025 WP_000284051.1.40031 WP_000284051.1.40072 WP_000284051.1.40073 WP_000284051.1.40081 WP_000284051.1.40095 WP_000284051.1.40097 WP_000284051.1.401 WP_000284051.1.4011 WP_000284051.1.40111 WP_000284051.1.40155 WP_000284051.1.40160 WP_000284051.1.40167 WP_000284051.1.40170 WP_000284051.1.40171 WP_000284051.1.40205 WP_000284051.1.40208 WP_000284051.1.40224 WP_000284051.1.40229 WP_000284051.1.40240 WP_000284051.1.40254 WP_000284051.1.40257 WP_000284051.1.40258 WP_000284051.1.40259 WP_000284051.1.40279 WP_000284051.1.40292 WP_000284051.1.40305 WP_000284051.1.40307 WP_000284051.1.40311 WP_000284051.1.40341 WP_000284051.1.40361 WP_000284051.1.4037 WP_000284051.1.40374 WP_000284051.1.40380 WP_000284051.1.40395 WP_000284051.1.40414 WP_000284051.1.4042 WP_000284051.1.40465 WP_000284051.1.40467 WP_000284051.1.40492 WP_000284051.1.40493 WP_000284051.1.40496 WP_000284051.1.40508 WP_000284051.1.40517 WP_000284051.1.40528 WP_000284051.1.40533 WP_000284051.1.40577 WP_000284051.1.40583 WP_000284051.1.40605 WP_000284051.1.40622 WP_000284051.1.40648 WP_000284051.1.40688 WP_000284051.1.40693 WP_000284051.1.40695 WP_000284051.1.40698 WP_000284051.1.40710 WP_000284051.1.40722 WP_000284051.1.40745 WP_000284051.1.4075 WP_000284051.1.40750 WP_000284051.1.40763 WP_000284051.1.40771 WP_000284051.1.40788 WP_000284051.1.40849 WP_000284051.1.40854 WP_000284051.1.4087 WP_000284051.1.40877 WP_000284051.1.4088 WP_000284051.1.4089 WP_000284051.1.40910 WP_000284051.1.40924 WP_000284051.1.40930 WP_000284051.1.40932 WP_000284051.1.40935 WP_000284051.1.40946 WP_000284051.1.40973 WP_000284051.1.40979 WP_000284051.1.40996 WP_000284051.1.41004 WP_000284051.1.41017 WP_000284051.1.41018 WP_000284051.1.41048 WP_000284051.1.41050 WP_000284051.1.4106 WP_000284051.1.41070 WP_000284051.1.41074 WP_000284051.1.41075 WP_000284051.1.41086 WP_000284051.1.4109 WP_000284051.1.41091 WP_000284051.1.41097 WP_000284051.1.41116 WP_000284051.1.41128 WP_000284051.1.41132 WP_000284051.1.4114 WP_000284051.1.41176 WP_000284051.1.41192 WP_000284051.1.41225 WP_000284051.1.41226 WP_000284051.1.41251 WP_000284051.1.41258 WP_000284051.1.41265 WP_000284051.1.41277 WP_000284051.1.41279 WP_000284051.1.41299 WP_000284051.1.41305 WP_000284051.1.41308 WP_000284051.1.41310 WP_000284051.1.41321 WP_000284051.1.41333 WP_000284051.1.41335 WP_000284051.1.41345 WP_000284051.1.4136 WP_000284051.1.41375 WP_000284051.1.41415 WP_000284051.1.41427 WP_000284051.1.41438 WP_000284051.1.41440 WP_000284051.1.41459 WP_000284051.1.41468 WP_000284051.1.41497 WP_000284051.1.41498 WP_000284051.1.41516 WP_000284051.1.41519 WP_000284051.1.41524 WP_000284051.1.41528 WP_000284051.1.41554 WP_000284051.1.41572 WP_000284051.1.41591 WP_000284051.1.41593 WP_000284051.1.41610 WP_000284051.1.41628 WP_000284051.1.41631 WP_000284051.1.41658 WP_000284051.1.41659 WP_000284051.1.41662 WP_000284051.1.41688 WP_000284051.1.41690 WP_000284051.1.41708 WP_000284051.1.41716 WP_000284051.1.41724 WP_000284051.1.41735 WP_000284051.1.41746 WP_000284051.1.41761 WP_000284051.1.41789 WP_000284051.1.41799 WP_000284051.1.41802 WP_000284051.1.41824 WP_000284051.1.41825 WP_000284051.1.41836 WP_000284051.1.4184 WP_000284051.1.41859 WP_000284051.1.41862 WP_000284051.1.41877 WP_000284051.1.41882 WP_000284051.1.41894 WP_000284051.1.41897 WP_000284051.1.41904 WP_000284051.1.41911 WP_000284051.1.41919 WP_000284051.1.41929 WP_000284051.1.41931 WP_000284051.1.41938 WP_000284051.1.4194 WP_000284051.1.41949 WP_000284051.1.41978 WP_000284051.1.41979 WP_000284051.1.41985 WP_000284051.1.41994 WP_000284051.1.41998 WP_000284051.1.42009 WP_000284051.1.42069 WP_000284051.1.42081 WP_000284051.1.42090 WP_000284051.1.42098 WP_000284051.1.42104 WP_000284051.1.42109 WP_000284051.1.42111 WP_000284051.1.42136 WP_000284051.1.42156 WP_000284051.1.42187 WP_000284051.1.422 WP_000284051.1.42200 WP_000284051.1.42219 WP_000284051.1.4222 WP_000284051.1.42238 WP_000284051.1.42243 WP_000284051.1.42244 WP_000284051.1.42248 WP_000284051.1.42257 WP_000284051.1.42261 WP_000284051.1.42263 WP_000284051.1.42276 WP_000284051.1.4229 WP_000284051.1.42320 WP_000284051.1.42322 WP_000284051.1.42328 WP_000284051.1.42342 WP_000284051.1.42349 WP_000284051.1.42356 WP_000284051.1.42364 WP_000284051.1.42371 WP_000284051.1.42372 WP_000284051.1.42379 WP_000284051.1.4239 WP_000284051.1.42391 WP_000284051.1.42392 WP_000284051.1.42394 WP_000284051.1.42399 WP_000284051.1.42404 WP_000284051.1.42422 WP_000284051.1.42433 WP_000284051.1.42444 WP_000284051.1.42453 WP_000284051.1.42489 WP_000284051.1.42491 WP_000284051.1.42539 WP_000284051.1.4254 WP_000284051.1.4257 WP_000284051.1.42595 WP_000284051.1.42603 WP_000284051.1.42605 WP_000284051.1.42650 WP_000284051.1.42655 WP_000284051.1.42666 WP_000284051.1.4267 WP_000284051.1.42675 WP_000284051.1.42676 WP_000284051.1.42683 WP_000284051.1.42685 WP_000284051.1.42701 WP_000284051.1.42707 WP_000284051.1.42734 WP_000284051.1.4276 WP_000284051.1.42767 WP_000284051.1.42794 WP_000284051.1.42797 WP_000284051.1.42805 WP_000284051.1.42815 WP_000284051.1.42829 WP_000284051.1.42859 WP_000284051.1.42861 WP_000284051.1.42864 WP_000284051.1.4288 WP_000284051.1.42887 WP_000284051.1.4289 WP_000284051.1.42892 WP_000284051.1.42923 WP_000284051.1.42932 WP_000284051.1.42957 WP_000284051.1.42978 WP_000284051.1.4298 WP_000284051.1.42981 WP_000284051.1.43008 WP_000284051.1.43016 WP_000284051.1.43018 WP_000284051.1.43019 WP_000284051.1.43041 WP_000284051.1.43065 WP_000284051.1.43068 WP_000284051.1.43069 WP_000284051.1.43070 WP_000284051.1.43077 WP_000284051.1.43086 WP_000284051.1.43089 WP_000284051.1.43126 WP_000284051.1.43128 WP_000284051.1.43141 WP_000284051.1.43149 WP_000284051.1.43157 WP_000284051.1.43160 WP_000284051.1.43161 WP_000284051.1.43190 WP_000284051.1.43198 WP_000284051.1.43201 WP_000284051.1.43244 WP_000284051.1.43258 WP_000284051.1.4326 WP_000284051.1.43272 WP_000284051.1.43276 WP_000284051.1.43290 WP_000284051.1.43292 WP_000284051.1.43299 WP_000284051.1.43307 WP_000284051.1.43312 WP_000284051.1.4332 WP_000284051.1.43334 WP_000284051.1.43339 WP_000284051.1.43351 WP_000284051.1.43371 WP_000284051.1.43437 WP_000284051.1.43438 WP_000284051.1.43441 WP_000284051.1.43476 WP_000284051.1.43508 WP_000284051.1.43513 WP_000284051.1.43520 WP_000284051.1.43522 WP_000284051.1.43528 WP_000284051.1.43535 WP_000284051.1.43606 WP_000284051.1.43613 WP_000284051.1.43633 WP_000284051.1.43637 WP_000284051.1.43651 WP_000284051.1.43654 WP_000284051.1.43668 WP_000284051.1.43676 WP_000284051.1.43685 WP_000284051.1.43710 WP_000284051.1.43711 WP_000284051.1.43722 WP_000284051.1.4373 WP_000284051.1.43763 WP_000284051.1.43778 WP_000284051.1.43782 WP_000284051.1.43785 WP_000284051.1.43801 WP_000284051.1.43812 WP_000284051.1.43828 WP_000284051.1.43839 WP_000284051.1.43864 WP_000284051.1.43873 WP_000284051.1.43875 WP_000284051.1.43878 WP_000284051.1.43886 WP_000284051.1.43888 WP_000284051.1.43919 WP_000284051.1.43951 WP_000284051.1.43954 WP_000284051.1.43974 WP_000284051.1.44005 WP_000284051.1.44010 WP_000284051.1.4404 WP_000284051.1.44043 WP_000284051.1.44049 WP_000284051.1.4405 WP_000284051.1.44063 WP_000284051.1.44099 WP_000284051.1.44101 WP_000284051.1.44113 WP_000284051.1.44121 WP_000284051.1.44132 WP_000284051.1.44144 WP_000284051.1.44160 WP_000284051.1.44180 WP_000284051.1.44187 WP_000284051.1.44191 WP_000284051.1.44196 WP_000284051.1.44208 WP_000284051.1.4422 WP_000284051.1.4423 WP_000284051.1.44248 WP_000284051.1.44250 WP_000284051.1.44262 WP_000284051.1.44268 WP_000284051.1.4427 WP_000284051.1.44291 WP_000284051.1.44296 WP_000284051.1.44300 WP_000284051.1.44310 WP_000284051.1.44337 WP_000284051.1.44339 WP_000284051.1.44343 WP_000284051.1.44351 WP_000284051.1.44359 WP_000284051.1.44360 WP_000284051.1.44380 WP_000284051.1.44386 WP_000284051.1.4440 WP_000284051.1.44416 WP_000284051.1.44431 WP_000284051.1.44433 WP_000284051.1.44437 WP_000284051.1.44438 WP_000284051.1.44440 WP_000284051.1.44443 WP_000284051.1.44453 WP_000284051.1.44474 WP_000284051.1.44479 WP_000284051.1.44546 WP_000284051.1.44549 WP_000284051.1.44578 WP_000284051.1.44593 WP_000284051.1.44606 WP_000284051.1.44607 WP_000284051.1.44633 WP_000284051.1.44636 WP_000284051.1.44640 WP_000284051.1.4467 WP_000284051.1.44678 WP_000284051.1.4468 WP_000284051.1.44687 WP_000284051.1.44702 WP_000284051.1.44705 WP_000284051.1.44747 WP_000284051.1.44762 WP_000284051.1.44781 WP_000284051.1.44791 WP_000284051.1.44795 WP_000284051.1.44815 WP_000284051.1.44828 WP_000284051.1.44831 WP_000284051.1.44833 WP_000284051.1.4485 WP_000284051.1.44877 WP_000284051.1.44879 WP_000284051.1.44887 WP_000284051.1.449 WP_000284051.1.44917 WP_000284051.1.44927 WP_000284051.1.44933 WP_000284051.1.44943 WP_000284051.1.44950 WP_000284051.1.44966 WP_000284051.1.44971 WP_000284051.1.44978 WP_000284051.1.44985 WP_000284051.1.44996 WP_000284051.1.44997 WP_000284051.1.44998 WP_000284051.1.4500 WP_000284051.1.4501 WP_000284051.1.45027 WP_000284051.1.45038 WP_000284051.1.45045 WP_000284051.1.4505 WP_000284051.1.45067 WP_000284051.1.45072 WP_000284051.1.45074 WP_000284051.1.45079 WP_000284051.1.45093 WP_000284051.1.45098 WP_000284051.1.45123 WP_000284051.1.45134 WP_000284051.1.45136 WP_000284051.1.45138 WP_000284051.1.45145 WP_000284051.1.45154 WP_000284051.1.45173 WP_000284051.1.45177 WP_000284051.1.45184 WP_000284051.1.45229 WP_000284051.1.45238 WP_000284051.1.45241 WP_000284051.1.45251 WP_000284051.1.45259 WP_000284051.1.45268 WP_000284051.1.45302 WP_000284051.1.4531 WP_000284051.1.45322 WP_000284051.1.45344 WP_000284051.1.45349 WP_000284051.1.45351 WP_000284051.1.45365 WP_000284051.1.4540 WP_000284051.1.45402 WP_000284051.1.45432 WP_000284051.1.45434 WP_000284051.1.45435 WP_000284051.1.45462 WP_000284051.1.45468 WP_000284051.1.45522 WP_000284051.1.45523 WP_000284051.1.45544 WP_000284051.1.45549 WP_000284051.1.45550 WP_000284051.1.45566 WP_000284051.1.45569 WP_000284051.1.45571 WP_000284051.1.45582 WP_000284051.1.45583 WP_000284051.1.45585 WP_000284051.1.45596 WP_000284051.1.45622 WP_000284051.1.45648 WP_000284051.1.45660 WP_000284051.1.45690 WP_000284051.1.45706 WP_000284051.1.45781 WP_000284051.1.45797 WP_000284051.1.458 WP_000284051.1.45829 WP_000284051.1.45844 WP_000284051.1.45848 WP_000284051.1.45871 WP_000284051.1.45906 WP_000284051.1.45918 WP_000284051.1.45943 WP_000284051.1.45973 WP_000284051.1.45984 WP_000284051.1.46011 WP_000284051.1.46028 WP_000284051.1.46030 WP_000284051.1.46069 WP_000284051.1.46077 WP_000284051.1.46091 WP_000284051.1.46112 WP_000284051.1.46124 WP_000284051.1.46169 WP_000284051.1.46173 WP_000284051.1.46174 WP_000284051.1.46187 WP_000284051.1.46203 WP_000284051.1.46205 WP_000284051.1.46215 WP_000284051.1.46225 WP_000284051.1.46232 WP_000284051.1.46241 WP_000284051.1.46243 WP_000284051.1.46250 WP_000284051.1.46278 WP_000284051.1.46286 WP_000284051.1.46299 WP_000284051.1.46303 WP_000284051.1.46307 WP_000284051.1.46322 WP_000284051.1.46323 WP_000284051.1.46345 WP_000284051.1.46355 WP_000284051.1.46358 WP_000284051.1.464 WP_000284051.1.46406 WP_000284051.1.46434 WP_000284051.1.46444 WP_000284051.1.46454 WP_000284051.1.46461 WP_000284051.1.46499 WP_000284051.1.46504 WP_000284051.1.46505 WP_000284051.1.46551 WP_000284051.1.46559 WP_000284051.1.46572 WP_000284051.1.46574 WP_000284051.1.46578 WP_000284051.1.46595 WP_000284051.1.46620 WP_000284051.1.46637 WP_000284051.1.46666 WP_000284051.1.46675 WP_000284051.1.46689 WP_000284051.1.46693 WP_000284051.1.46701 WP_000284051.1.4671 WP_000284051.1.46726 WP_000284051.1.46730 WP_000284051.1.46732 WP_000284051.1.4674 WP_000284051.1.46749 WP_000284051.1.46781 WP_000284051.1.46803 WP_000284051.1.46804 WP_000284051.1.46816 WP_000284051.1.46842 WP_000284051.1.4686 WP_000284051.1.4690 WP_000284051.1.46920 WP_000284051.1.46930 WP_000284051.1.46945 WP_000284051.1.46961 WP_000284051.1.46967 WP_000284051.1.46975 WP_000284051.1.46976 WP_000284051.1.47005 WP_000284051.1.47008 WP_000284051.1.47014 WP_000284051.1.47023 WP_000284051.1.47036 WP_000284051.1.47037 WP_000284051.1.47042 WP_000284051.1.47057 WP_000284051.1.47058 WP_000284051.1.47059 WP_000284051.1.47061 WP_000284051.1.47067 WP_000284051.1.47085 WP_000284051.1.47110 WP_000284051.1.47123 WP_000284051.1.47214 WP_000284051.1.47215 WP_000284051.1.47243 WP_000284051.1.47245 WP_000284051.1.47257 WP_000284051.1.47389 WP_000284051.1.47429 WP_000284051.1.47442 WP_000284051.1.47448 WP_000284051.1.47460 WP_000284051.1.4747 WP_000284051.1.47472 WP_000284051.1.47478 WP_000284051.1.47482 WP_000284051.1.47492 WP_000284051.1.47506 WP_000284051.1.47507 WP_000284051.1.47523 WP_000284051.1.47531 WP_000284051.1.47532 WP_000284051.1.47542 WP_000284051.1.47567 WP_000284051.1.47576 WP_000284051.1.47579 WP_000284051.1.4758 WP_000284051.1.47587 WP_000284051.1.47605 WP_000284051.1.47614 WP_000284051.1.47621 WP_000284051.1.47630 WP_000284051.1.47660 WP_000284051.1.4769 WP_000284051.1.4770 WP_000284051.1.47714 WP_000284051.1.4774 WP_000284051.1.4775 WP_000284051.1.47756 WP_000284051.1.47767 WP_000284051.1.47799 WP_000284051.1.4781 WP_000284051.1.47814 WP_000284051.1.47817 WP_000284051.1.47829 WP_000284051.1.47849 WP_000284051.1.47850 WP_000284051.1.47886 WP_000284051.1.47898 WP_000284051.1.47902 WP_000284051.1.47911 WP_000284051.1.47928 WP_000284051.1.4795 WP_000284051.1.47988 WP_000284051.1.47992 WP_000284051.1.48019 WP_000284051.1.48033 WP_000284051.1.48100 WP_000284051.1.48114 WP_000284051.1.48124 WP_000284051.1.48132 WP_000284051.1.48134 WP_000284051.1.48139 WP_000284051.1.48190 WP_000284051.1.48209 WP_000284051.1.48215 WP_000284051.1.48218 WP_000284051.1.48242 WP_000284051.1.48244 WP_000284051.1.48247 WP_000284051.1.48253 WP_000284051.1.48262 WP_000284051.1.48292 WP_000284051.1.483 WP_000284051.1.48324 WP_000284051.1.48342 WP_000284051.1.48367 WP_000284051.1.48377 WP_000284051.1.4839 WP_000284051.1.48399 WP_000284051.1.48426 WP_000284051.1.48430 WP_000284051.1.48436 WP_000284051.1.48455 WP_000284051.1.48493 WP_000284051.1.48510 WP_000284051.1.48524 WP_000284051.1.4853 WP_000284051.1.48570 WP_000284051.1.48586 WP_000284051.1.4859 WP_000284051.1.48591 WP_000284051.1.48610 WP_000284051.1.48631 WP_000284051.1.48647 WP_000284051.1.48651 WP_000284051.1.48663 WP_000284051.1.48690 WP_000284051.1.48734 WP_000284051.1.48751 WP_000284051.1.48755 WP_000284051.1.48756 WP_000284051.1.48768 WP_000284051.1.48774 WP_000284051.1.48778 WP_000284051.1.48788 WP_000284051.1.48797 WP_000284051.1.48841 WP_000284051.1.48849 WP_000284051.1.4885 WP_000284051.1.48855 WP_000284051.1.48876 WP_000284051.1.48886 WP_000284051.1.48894 WP_000284051.1.48896 WP_000284051.1.48908 WP_000284051.1.48918 WP_000284051.1.48919 WP_000284051.1.48931 WP_000284051.1.48955 WP_000284051.1.48963 WP_000284051.1.48973 WP_000284051.1.48985 WP_000284051.1.49004 WP_000284051.1.49005 WP_000284051.1.49012 WP_000284051.1.49084 WP_000284051.1.49090 WP_000284051.1.49102 WP_000284051.1.49106 WP_000284051.1.49113 WP_000284051.1.49117 WP_000284051.1.49121 WP_000284051.1.4914 WP_000284051.1.49153 WP_000284051.1.49155 WP_000284051.1.49162 WP_000284051.1.49166 WP_000284051.1.49175 WP_000284051.1.49204 WP_000284051.1.49214 WP_000284051.1.49226 WP_000284051.1.49233 WP_000284051.1.49239 WP_000284051.1.49256 WP_000284051.1.49262 WP_000284051.1.49274 WP_000284051.1.49276 WP_000284051.1.49290 WP_000284051.1.49302 WP_000284051.1.49304 WP_000284051.1.49309 WP_000284051.1.49311 WP_000284051.1.49334 WP_000284051.1.49340 WP_000284051.1.49355 WP_000284051.1.49358 WP_000284051.1.49366 WP_000284051.1.49375 WP_000284051.1.49429 WP_000284051.1.49430 WP_000284051.1.49434 WP_000284051.1.49443 WP_000284051.1.49450 WP_000284051.1.49490 WP_000284051.1.49494 WP_000284051.1.495 WP_000284051.1.49515 WP_000284051.1.49534 WP_000284051.1.49545 WP_000284051.1.49572 WP_000284051.1.49574 WP_000284051.1.49590 WP_000284051.1.49595 WP_000284051.1.49602 WP_000284051.1.49626 WP_000284051.1.49630 WP_000284051.1.49650 WP_000284051.1.49686 WP_000284051.1.49703 WP_000284051.1.49710 WP_000284051.1.49769 WP_000284051.1.49770 WP_000284051.1.49778 WP_000284051.1.49780 WP_000284051.1.4979 WP_000284051.1.49790 WP_000284051.1.49803 WP_000284051.1.49805 WP_000284051.1.49827 WP_000284051.1.49846 WP_000284051.1.49848 WP_000284051.1.4991 WP_000284051.1.49929 WP_000284051.1.49931 WP_000284051.1.49947 WP_000284051.1.49959 WP_000284051.1.49997 WP_000284051.1.50 WP_000284051.1.50003 WP_000284051.1.50007 WP_000284051.1.50014 WP_000284051.1.50030 WP_000284051.1.50043 WP_000284051.1.50080 WP_000284051.1.5009 WP_000284051.1.50103 WP_000284051.1.50128 WP_000284051.1.50153 WP_000284051.1.50158 WP_000284051.1.50161 WP_000284051.1.50198 WP_000284051.1.50211 WP_000284051.1.50238 WP_000284051.1.50239 WP_000284051.1.50247 WP_000284051.1.50251 WP_000284051.1.50285 WP_000284051.1.50308 WP_000284051.1.50309 WP_000284051.1.50332 WP_000284051.1.50349 WP_000284051.1.50374 WP_000284051.1.50376 WP_000284051.1.50386 WP_000284051.1.50387 WP_000284051.1.50389 WP_000284051.1.50404 WP_000284051.1.50406 WP_000284051.1.50413 WP_000284051.1.50449 WP_000284051.1.50468 WP_000284051.1.50469 WP_000284051.1.50478 WP_000284051.1.50480 WP_000284051.1.50497 WP_000284051.1.5051 WP_000284051.1.50517 WP_000284051.1.50529 WP_000284051.1.50563 WP_000284051.1.50565 WP_000284051.1.50566 WP_000284051.1.50570 WP_000284051.1.50576 WP_000284051.1.5058 WP_000284051.1.50593 WP_000284051.1.50626 WP_000284051.1.50652 WP_000284051.1.50676 WP_000284051.1.50684 WP_000284051.1.50726 WP_000284051.1.50750 WP_000284051.1.50769 WP_000284051.1.50771 WP_000284051.1.50774 WP_000284051.1.50777 WP_000284051.1.50782 WP_000284051.1.50800 WP_000284051.1.50804 WP_000284051.1.50808 WP_000284051.1.50811 WP_000284051.1.50875 WP_000284051.1.5088 WP_000284051.1.50882 WP_000284051.1.50885 WP_000284051.1.50893 WP_000284051.1.509 WP_000284051.1.50908 WP_000284051.1.50918 WP_000284051.1.50929 WP_000284051.1.50941 WP_000284051.1.50954 WP_000284051.1.50960 WP_000284051.1.50970 WP_000284051.1.50999 WP_000284051.1.51014 WP_000284051.1.51022 WP_000284051.1.51025 WP_000284051.1.51036 WP_000284051.1.51040 WP_000284051.1.51048 WP_000284051.1.51066 WP_000284051.1.51100 WP_000284051.1.51117 WP_000284051.1.51134 WP_000284051.1.5114 WP_000284051.1.51162 WP_000284051.1.51178 WP_000284051.1.51179 WP_000284051.1.51182 WP_000284051.1.51186 WP_000284051.1.51224 WP_000284051.1.51227 WP_000284051.1.5125 WP_000284051.1.5127 WP_000284051.1.51285 WP_000284051.1.51305 WP_000284051.1.51308 WP_000284051.1.51315 WP_000284051.1.51331 WP_000284051.1.51338 WP_000284051.1.51356 WP_000284051.1.5136 WP_000284051.1.5138 WP_000284051.1.51394 WP_000284051.1.51412 WP_000284051.1.51414 WP_000284051.1.51419 WP_000284051.1.51451 WP_000284051.1.51458 WP_000284051.1.51464 WP_000284051.1.51474 WP_000284051.1.51487 WP_000284051.1.51488 WP_000284051.1.51502 WP_000284051.1.51506 WP_000284051.1.51514 WP_000284051.1.51518 WP_000284051.1.51519 WP_000284051.1.51555 WP_000284051.1.51594 WP_000284051.1.51598 WP_000284051.1.51611 WP_000284051.1.51613 WP_000284051.1.51615 WP_000284051.1.51634 WP_000284051.1.51642 WP_000284051.1.51644 WP_000284051.1.51649 WP_000284051.1.51686 WP_000284051.1.51700 WP_000284051.1.51704 WP_000284051.1.51724 WP_000284051.1.51734 WP_000284051.1.51756 WP_000284051.1.51764 WP_000284051.1.51810 WP_000284051.1.51831 WP_000284051.1.51838 WP_000284051.1.51841 WP_000284051.1.5185 WP_000284051.1.51863 WP_000284051.1.51868 WP_000284051.1.51888 WP_000284051.1.51900 WP_000284051.1.51910 WP_000284051.1.51911 WP_000284051.1.51914 WP_000284051.1.51915 WP_000284051.1.51930 WP_000284051.1.51932 WP_000284051.1.51935 WP_000284051.1.51989 WP_000284051.1.51994 WP_000284051.1.520 WP_000284051.1.52047 WP_000284051.1.52057 WP_000284051.1.52101 WP_000284051.1.5211 WP_000284051.1.52114 WP_000284051.1.52121 WP_000284051.1.52123 WP_000284051.1.52129 WP_000284051.1.52148 WP_000284051.1.52156 WP_000284051.1.5216 WP_000284051.1.52161 WP_000284051.1.52170 WP_000284051.1.52191 WP_000284051.1.52202 WP_000284051.1.52209 WP_000284051.1.52255 WP_000284051.1.52301 WP_000284051.1.52321 WP_000284051.1.52336 WP_000284051.1.52339 WP_000284051.1.52346 WP_000284051.1.52356 WP_000284051.1.52361 WP_000284051.1.52438 WP_000284051.1.52446 WP_000284051.1.52456 WP_000284051.1.52469 WP_000284051.1.52527 WP_000284051.1.52528 WP_000284051.1.52571 WP_000284051.1.52582 WP_000284051.1.52586 WP_000284051.1.526 WP_000284051.1.52608 WP_000284051.1.52637 WP_000284051.1.52647 WP_000284051.1.52653 WP_000284051.1.52656 WP_000284051.1.52675 WP_000284051.1.52692 WP_000284051.1.5273 WP_000284051.1.52738 WP_000284051.1.52742 WP_000284051.1.52743 WP_000284051.1.52744 WP_000284051.1.52748 WP_000284051.1.52773 WP_000284051.1.52795 WP_000284051.1.52807 WP_000284051.1.52824 WP_000284051.1.52833 WP_000284051.1.52851 WP_000284051.1.52857 WP_000284051.1.52858 WP_000284051.1.52866 WP_000284051.1.52887 WP_000284051.1.52898 WP_000284051.1.52915 WP_000284051.1.52924 WP_000284051.1.52949 WP_000284051.1.52985 WP_000284051.1.5301 WP_000284051.1.53016 WP_000284051.1.53092 WP_000284051.1.53100 WP_000284051.1.53107 WP_000284051.1.53119 WP_000284051.1.5313 WP_000284051.1.53141 WP_000284051.1.53151 WP_000284051.1.53154 WP_000284051.1.53158 WP_000284051.1.53159 WP_000284051.1.5316 WP_000284051.1.53179 WP_000284051.1.53190 WP_000284051.1.53198 WP_000284051.1.53203 WP_000284051.1.53206 WP_000284051.1.53210 WP_000284051.1.53233 WP_000284051.1.53234 WP_000284051.1.53272 WP_000284051.1.53274 WP_000284051.1.53286 WP_000284051.1.53307 WP_000284051.1.53315 WP_000284051.1.53316 WP_000284051.1.53321 WP_000284051.1.53328 WP_000284051.1.5333 WP_000284051.1.53362 WP_000284051.1.53368 WP_000284051.1.53375 WP_000284051.1.53385 WP_000284051.1.53406 WP_000284051.1.53436 WP_000284051.1.53450 WP_000284051.1.53454 WP_000284051.1.53466 WP_000284051.1.5349 WP_000284051.1.53529 WP_000284051.1.53534 WP_000284051.1.53540 WP_000284051.1.53543 WP_000284051.1.53555 WP_000284051.1.53559 WP_000284051.1.5356 WP_000284051.1.53567 WP_000284051.1.53571 WP_000284051.1.5358 WP_000284051.1.53664 WP_000284051.1.53675 WP_000284051.1.53688 WP_000284051.1.53692 WP_000284051.1.53694 WP_000284051.1.53696 WP_000284051.1.53723 WP_000284051.1.5374 WP_000284051.1.53750 WP_000284051.1.53757 WP_000284051.1.53772 WP_000284051.1.53778 WP_000284051.1.53781 WP_000284051.1.53790 WP_000284051.1.53800 WP_000284051.1.53812 WP_000284051.1.53814 WP_000284051.1.53815 WP_000284051.1.53839 WP_000284051.1.53892 WP_000284051.1.53896 WP_000284051.1.53898 WP_000284051.1.53902 WP_000284051.1.53905 WP_000284051.1.5392 WP_000284051.1.53935 WP_000284051.1.53958 WP_000284051.1.53961 WP_000284051.1.53981 WP_000284051.1.53984 WP_000284051.1.54033 WP_000284051.1.54061 WP_000284051.1.54068 WP_000284051.1.54075 WP_000284051.1.54082 WP_000284051.1.54085 WP_000284051.1.54132 WP_000284051.1.54136 WP_000284051.1.5415 WP_000284051.1.54159 WP_000284051.1.54170 WP_000284051.1.54175 WP_000284051.1.54196 WP_000284051.1.542 WP_000284051.1.54203 WP_000284051.1.54209 WP_000284051.1.54259 WP_000284051.1.54271 WP_000284051.1.54273 WP_000284051.1.54274 WP_000284051.1.54283 WP_000284051.1.5430 WP_000284051.1.54319 WP_000284051.1.54324 WP_000284051.1.54333 WP_000284051.1.54340 WP_000284051.1.54364 WP_000284051.1.54366 WP_000284051.1.54371 WP_000284051.1.54400 WP_000284051.1.54431 WP_000284051.1.54442 WP_000284051.1.54482 WP_000284051.1.54522 WP_000284051.1.54526 WP_000284051.1.54558 WP_000284051.1.5456 WP_000284051.1.54569 WP_000284051.1.54589 WP_000284051.1.5459 WP_000284051.1.54607 WP_000284051.1.54615 WP_000284051.1.5462 WP_000284051.1.54644 WP_000284051.1.54662 WP_000284051.1.54667 WP_000284051.1.54678 WP_000284051.1.54681 WP_000284051.1.54694 WP_000284051.1.54722 WP_000284051.1.54748 WP_000284051.1.54749 WP_000284051.1.54764 WP_000284051.1.54774 WP_000284051.1.5481 WP_000284051.1.54814 WP_000284051.1.54822 WP_000284051.1.54827 WP_000284051.1.54833 WP_000284051.1.54845 WP_000284051.1.5485 WP_000284051.1.54865 WP_000284051.1.54877 WP_000284051.1.5493 WP_000284051.1.54935 WP_000284051.1.54936 WP_000284051.1.54979 WP_000284051.1.54984 WP_000284051.1.54992 WP_000284051.1.55008 WP_000284051.1.55010 WP_000284051.1.55034 WP_000284051.1.55073 WP_000284051.1.55152 WP_000284051.1.55156 WP_000284051.1.55163 WP_000284051.1.55165 WP_000284051.1.55166 WP_000284051.1.5517 WP_000284051.1.55178 WP_000284051.1.55200 WP_000284051.1.55215 WP_000284051.1.55223 WP_000284051.1.55224 WP_000284051.1.5523 WP_000284051.1.5525 WP_000284051.1.5527 WP_000284051.1.55285 WP_000284051.1.55290 WP_000284051.1.55294 WP_000284051.1.55310 WP_000284051.1.55317 WP_000284051.1.55325 WP_000284051.1.55361 WP_000284051.1.55379 WP_000284051.1.5539 WP_000284051.1.55418 WP_000284051.1.55430 WP_000284051.1.55461 WP_000284051.1.55468 WP_000284051.1.55475 WP_000284051.1.55477 WP_000284051.1.55496 WP_000284051.1.55500 WP_000284051.1.55506 WP_000284051.1.5552 WP_000284051.1.55528 WP_000284051.1.55545 WP_000284051.1.5555 WP_000284051.1.55554 WP_000284051.1.55557 WP_000284051.1.55559 WP_000284051.1.5560 WP_000284051.1.55604 WP_000284051.1.55614 WP_000284051.1.55623 WP_000284051.1.55639 WP_000284051.1.55640 WP_000284051.1.55647 WP_000284051.1.55672 WP_000284051.1.55680 WP_000284051.1.55699 WP_000284051.1.55706 WP_000284051.1.55718 WP_000284051.1.5572 WP_000284051.1.55725 WP_000284051.1.55743 WP_000284051.1.55768 WP_000284051.1.5577 WP_000284051.1.55780 WP_000284051.1.55782 WP_000284051.1.55796 WP_000284051.1.55803 WP_000284051.1.55923 WP_000284051.1.55948 WP_000284051.1.55967 WP_000284051.1.55973 WP_000284051.1.55993 WP_000284051.1.55995 WP_000284051.1.56002 WP_000284051.1.56004 WP_000284051.1.56012 WP_000284051.1.56026 WP_000284051.1.56059 WP_000284051.1.56069 WP_000284051.1.56070 WP_000284051.1.56082 WP_000284051.1.56097 WP_000284051.1.56100 WP_000284051.1.56105 WP_000284051.1.56130 WP_000284051.1.56144 WP_000284051.1.56152 WP_000284051.1.56172 WP_000284051.1.5621 WP_000284051.1.56222 WP_000284051.1.56226 WP_000284051.1.56235 WP_000284051.1.56238 WP_000284051.1.56244 WP_000284051.1.56247 WP_000284051.1.56261 WP_000284051.1.56263 WP_000284051.1.56286 WP_000284051.1.56303 WP_000284051.1.56304 WP_000284051.1.56305 WP_000284051.1.56311 WP_000284051.1.5633 WP_000284051.1.56354 WP_000284051.1.56368 WP_000284051.1.56370 WP_000284051.1.56374 WP_000284051.1.56385 WP_000284051.1.56389 WP_000284051.1.56393 WP_000284051.1.56396 WP_000284051.1.56413 WP_000284051.1.56414 WP_000284051.1.56419 WP_000284051.1.56420 WP_000284051.1.56423 WP_000284051.1.56438 WP_000284051.1.56459 WP_000284051.1.56468 WP_000284051.1.56512 WP_000284051.1.56514 WP_000284051.1.56535 WP_000284051.1.56559 WP_000284051.1.56585 WP_000284051.1.56597 WP_000284051.1.56601 WP_000284051.1.56614 WP_000284051.1.56615 WP_000284051.1.56640 WP_000284051.1.56642 WP_000284051.1.56647 WP_000284051.1.56651 WP_000284051.1.56660 WP_000284051.1.56671 WP_000284051.1.5668 WP_000284051.1.56682 WP_000284051.1.56724 WP_000284051.1.56791 WP_000284051.1.56824 WP_000284051.1.56825 WP_000284051.1.56851 WP_000284051.1.56853 WP_000284051.1.56861 WP_000284051.1.56875 WP_000284051.1.56877 WP_000284051.1.56887 WP_000284051.1.56889 WP_000284051.1.56893 WP_000284051.1.56898 WP_000284051.1.56905 WP_000284051.1.56942 WP_000284051.1.56981 WP_000284051.1.57000 WP_000284051.1.57026 WP_000284051.1.57039 WP_000284051.1.57056 WP_000284051.1.57076 WP_000284051.1.57084 WP_000284051.1.57101 WP_000284051.1.5711 WP_000284051.1.57125 WP_000284051.1.57137 WP_000284051.1.57143 WP_000284051.1.57147 WP_000284051.1.57149 WP_000284051.1.57168 WP_000284051.1.57179 WP_000284051.1.57186 WP_000284051.1.57187 WP_000284051.1.57232 WP_000284051.1.57233 WP_000284051.1.57244 WP_000284051.1.57246 WP_000284051.1.57296 WP_000284051.1.57307 WP_000284051.1.57342 WP_000284051.1.57344 WP_000284051.1.57356 WP_000284051.1.57357 WP_000284051.1.57362 WP_000284051.1.57377 WP_000284051.1.57399 WP_000284051.1.57418 WP_000284051.1.57433 WP_000284051.1.57494 WP_000284051.1.57495 WP_000284051.1.57515 WP_000284051.1.57521 WP_000284051.1.57529 WP_000284051.1.5753 WP_000284051.1.57534 WP_000284051.1.57555 WP_000284051.1.57559 WP_000284051.1.57576 WP_000284051.1.57601 WP_000284051.1.57607 WP_000284051.1.5761 WP_000284051.1.57631 WP_000284051.1.57684 WP_000284051.1.57699 WP_000284051.1.57709 WP_000284051.1.57710 WP_000284051.1.57735 WP_000284051.1.5774 WP_000284051.1.57763 WP_000284051.1.57778 WP_000284051.1.57781 WP_000284051.1.57785 WP_000284051.1.57797 WP_000284051.1.57800 WP_000284051.1.5781 WP_000284051.1.57835 WP_000284051.1.57857 WP_000284051.1.57862 WP_000284051.1.57873 WP_000284051.1.57890 WP_000284051.1.57891 WP_000284051.1.57893 WP_000284051.1.57902 WP_000284051.1.57965 WP_000284051.1.57972 WP_000284051.1.57978 WP_000284051.1.58008 WP_000284051.1.5801 WP_000284051.1.58040 WP_000284051.1.58041 WP_000284051.1.58044 WP_000284051.1.58053 WP_000284051.1.58081 WP_000284051.1.5809 WP_000284051.1.58090 WP_000284051.1.58131 WP_000284051.1.58132 WP_000284051.1.58144 WP_000284051.1.58153 WP_000284051.1.58157 WP_000284051.1.58173 WP_000284051.1.58191 WP_000284051.1.58194 WP_000284051.1.58239 WP_000284051.1.58249 WP_000284051.1.58251 WP_000284051.1.58252 WP_000284051.1.58261 WP_000284051.1.58274 WP_000284051.1.5828 WP_000284051.1.58282 WP_000284051.1.58290 WP_000284051.1.58301 WP_000284051.1.58324 WP_000284051.1.58326 WP_000284051.1.58334 WP_000284051.1.58357 WP_000284051.1.58358 WP_000284051.1.5836 WP_000284051.1.58372 WP_000284051.1.58407 WP_000284051.1.58416 WP_000284051.1.58418 WP_000284051.1.58442 WP_000284051.1.58443 WP_000284051.1.58451 WP_000284051.1.5846 WP_000284051.1.58467 WP_000284051.1.58485 WP_000284051.1.58486 WP_000284051.1.58489 WP_000284051.1.58537 WP_000284051.1.5854 WP_000284051.1.58548 WP_000284051.1.58564 WP_000284051.1.58568 WP_000284051.1.5858 WP_000284051.1.58583 WP_000284051.1.58604 WP_000284051.1.58633 WP_000284051.1.58648 WP_000284051.1.58652 WP_000284051.1.58662 WP_000284051.1.58663 WP_000284051.1.58669 WP_000284051.1.58675 WP_000284051.1.58698 WP_000284051.1.58724 WP_000284051.1.58729 WP_000284051.1.58744 WP_000284051.1.58745 WP_000284051.1.5875 WP_000284051.1.58770 WP_000284051.1.5878 WP_000284051.1.58796 WP_000284051.1.58803 WP_000284051.1.58807 WP_000284051.1.58831 WP_000284051.1.58834 WP_000284051.1.58836 WP_000284051.1.58847 WP_000284051.1.5886 WP_000284051.1.58861 WP_000284051.1.58883 WP_000284051.1.58884 WP_000284051.1.58898 WP_000284051.1.58926 WP_000284051.1.58932 WP_000284051.1.58949 WP_000284051.1.58963 WP_000284051.1.58970 WP_000284051.1.58974 WP_000284051.1.59006 WP_000284051.1.59012 WP_000284051.1.59020 WP_000284051.1.59043 WP_000284051.1.59056 WP_000284051.1.59061 WP_000284051.1.59064 WP_000284051.1.59068 WP_000284051.1.5907 WP_000284051.1.59084 WP_000284051.1.59094 WP_000284051.1.59097 WP_000284051.1.59125 WP_000284051.1.59136 WP_000284051.1.59142 WP_000284051.1.59148 WP_000284051.1.59163 WP_000284051.1.59204 WP_000284051.1.59224 WP_000284051.1.59236 WP_000284051.1.59276 WP_000284051.1.59282 WP_000284051.1.5929 WP_000284051.1.59294 WP_000284051.1.59295 WP_000284051.1.59299 WP_000284051.1.59313 WP_000284051.1.59336 WP_000284051.1.59375 WP_000284051.1.59381 WP_000284051.1.59412 WP_000284051.1.59420 WP_000284051.1.59427 WP_000284051.1.59439 WP_000284051.1.59458 WP_000284051.1.59486 WP_000284051.1.5949 WP_000284051.1.59490 WP_000284051.1.59501 WP_000284051.1.59508 WP_000284051.1.59510 WP_000284051.1.59512 WP_000284051.1.59521 WP_000284051.1.5953 WP_000284051.1.59538 WP_000284051.1.59548 WP_000284051.1.59562 WP_000284051.1.59587 WP_000284051.1.59604 WP_000284051.1.59636 WP_000284051.1.59641 WP_000284051.1.59646 WP_000284051.1.59648 WP_000284051.1.59684 WP_000284051.1.5969 WP_000284051.1.59694 WP_000284051.1.59710 WP_000284051.1.59751 WP_000284051.1.59755 WP_000284051.1.59771 WP_000284051.1.5979 WP_000284051.1.59827 WP_000284051.1.59829 WP_000284051.1.59830 WP_000284051.1.59847 WP_000284051.1.59848 WP_000284051.1.59863 WP_000284051.1.59928 WP_000284051.1.5993 WP_000284051.1.59933 WP_000284051.1.59953 WP_000284051.1.59969 WP_000284051.1.59979 WP_000284051.1.59994 WP_000284051.1.60004 WP_000284051.1.60008 WP_000284051.1.60015 WP_000284051.1.60021 WP_000284051.1.60045 WP_000284051.1.60052 WP_000284051.1.60069 WP_000284051.1.60076 WP_000284051.1.60106 WP_000284051.1.60114 WP_000284051.1.60126 WP_000284051.1.60137 WP_000284051.1.60140 WP_000284051.1.60154 WP_000284051.1.60155 WP_000284051.1.60168 WP_000284051.1.60192 WP_000284051.1.60199 WP_000284051.1.60209 WP_000284051.1.60212 WP_000284051.1.60213 WP_000284051.1.60226 WP_000284051.1.60231 WP_000284051.1.60253 WP_000284051.1.60285 WP_000284051.1.60320 WP_000284051.1.60322 WP_000284051.1.60324 WP_000284051.1.6033 WP_000284051.1.60330 WP_000284051.1.60356 WP_000284051.1.60370 WP_000284051.1.60379 WP_000284051.1.6038 WP_000284051.1.60380 WP_000284051.1.6041 WP_000284051.1.60424 WP_000284051.1.60425 WP_000284051.1.60464 WP_000284051.1.60469 WP_000284051.1.60481 WP_000284051.1.60486 WP_000284051.1.605 WP_000284051.1.60503 WP_000284051.1.60507 WP_000284051.1.6052 WP_000284051.1.60545 WP_000284051.1.60560 WP_000284051.1.60561 WP_000284051.1.6058 WP_000284051.1.60584 WP_000284051.1.60597 WP_000284051.1.6060 WP_000284051.1.60608 WP_000284051.1.60622 WP_000284051.1.60643 WP_000284051.1.60676 WP_000284051.1.60708 WP_000284051.1.60713 WP_000284051.1.60725 WP_000284051.1.60746 WP_000284051.1.60760 WP_000284051.1.60772 WP_000284051.1.60783 WP_000284051.1.60792 WP_000284051.1.60794 WP_000284051.1.608 WP_000284051.1.60807 WP_000284051.1.60809 WP_000284051.1.60838 WP_000284051.1.60851 WP_000284051.1.60855 WP_000284051.1.60857 WP_000284051.1.6086 WP_000284051.1.60863 WP_000284051.1.60866 WP_000284051.1.60874 WP_000284051.1.60882 WP_000284051.1.60889 WP_000284051.1.60897 WP_000284051.1.6090 WP_000284051.1.60918 WP_000284051.1.60919 WP_000284051.1.60926 WP_000284051.1.60930 WP_000284051.1.60941 WP_000284051.1.60950 WP_000284051.1.60976 WP_000284051.1.60988 WP_000284051.1.60990 WP_000284051.1.6104 WP_000284051.1.61044 WP_000284051.1.61045 WP_000284051.1.61076 WP_000284051.1.61078 WP_000284051.1.6108 WP_000284051.1.61087 WP_000284051.1.61114 WP_000284051.1.61123 WP_000284051.1.6114 WP_000284051.1.61146 WP_000284051.1.61147 WP_000284051.1.61168 WP_000284051.1.61184 WP_000284051.1.61200 WP_000284051.1.61201 WP_000284051.1.61210 WP_000284051.1.61218 WP_000284051.1.61232 WP_000284051.1.61233 WP_000284051.1.6129 WP_000284051.1.61296 WP_000284051.1.61309 WP_000284051.1.61345 WP_000284051.1.61356 WP_000284051.1.61357 WP_000284051.1.61381 WP_000284051.1.61417 WP_000284051.1.6143 WP_000284051.1.61434 WP_000284051.1.61497 WP_000284051.1.61501 WP_000284051.1.61509 WP_000284051.1.61511 WP_000284051.1.61519 WP_000284051.1.61539 WP_000284051.1.61542 WP_000284051.1.61553 WP_000284051.1.61574 WP_000284051.1.61582 WP_000284051.1.61594 WP_000284051.1.61595 WP_000284051.1.61609 WP_000284051.1.6164 WP_000284051.1.61649 WP_000284051.1.61652 WP_000284051.1.61662 WP_000284051.1.61667 WP_000284051.1.61671 WP_000284051.1.61694 WP_000284051.1.61697 WP_000284051.1.61712 WP_000284051.1.61714 WP_000284051.1.61730 WP_000284051.1.61732 WP_000284051.1.61737 WP_000284051.1.61743 WP_000284051.1.61783 WP_000284051.1.61809 WP_000284051.1.61857 WP_000284051.1.61877 WP_000284051.1.6190 WP_000284051.1.61908 WP_000284051.1.61918 WP_000284051.1.61920 WP_000284051.1.61922 WP_000284051.1.61924 WP_000284051.1.61952 WP_000284051.1.61968 WP_000284051.1.62007 WP_000284051.1.62020 WP_000284051.1.62025 WP_000284051.1.62063 WP_000284051.1.62076 WP_000284051.1.6209 WP_000284051.1.6210 WP_000284051.1.62108 WP_000284051.1.62120 WP_000284051.1.62122 WP_000284051.1.62124 WP_000284051.1.62142 WP_000284051.1.62144 WP_000284051.1.62158 WP_000284051.1.62184 WP_000284051.1.62195 WP_000284051.1.62199 WP_000284051.1.62201 WP_000284051.1.62204 WP_000284051.1.62210 WP_000284051.1.62219 WP_000284051.1.62222 WP_000284051.1.62223 WP_000284051.1.62241 WP_000284051.1.62257 WP_000284051.1.62271 WP_000284051.1.62302 WP_000284051.1.62304 WP_000284051.1.62310 WP_000284051.1.62314 WP_000284051.1.62323 WP_000284051.1.62333 WP_000284051.1.62338 WP_000284051.1.62339 WP_000284051.1.62344 WP_000284051.1.62361 WP_000284051.1.62364 WP_000284051.1.62374 WP_000284051.1.62380 WP_000284051.1.62403 WP_000284051.1.62404 WP_000284051.1.62407 WP_000284051.1.62411 WP_000284051.1.62412 WP_000284051.1.62436 WP_000284051.1.62442 WP_000284051.1.62475 WP_000284051.1.62486 WP_000284051.1.62488 WP_000284051.1.62504 WP_000284051.1.62522 WP_000284051.1.6253 WP_000284051.1.62536 WP_000284051.1.62564 WP_000284051.1.62570 WP_000284051.1.62619 WP_000284051.1.62640 WP_000284051.1.62648 WP_000284051.1.62669 WP_000284051.1.62677 WP_000284051.1.62686 WP_000284051.1.62693 WP_000284051.1.627 WP_000284051.1.62725 WP_000284051.1.62745 WP_000284051.1.62751 WP_000284051.1.62757 WP_000284051.1.62798 WP_000284051.1.62825 WP_000284051.1.62828 WP_000284051.1.62853 WP_000284051.1.62903 WP_000284051.1.62910 WP_000284051.1.62913 WP_000284051.1.6292 WP_000284051.1.62932 WP_000284051.1.62955 WP_000284051.1.62960 WP_000284051.1.62976 WP_000284051.1.62983 WP_000284051.1.62988 WP_000284051.1.63016 WP_000284051.1.63025 WP_000284051.1.63043 WP_000284051.1.63045 WP_000284051.1.63063 WP_000284051.1.63069 WP_000284051.1.63087 WP_000284051.1.63102 WP_000284051.1.63118 WP_000284051.1.63129 WP_000284051.1.63135 WP_000284051.1.63150 WP_000284051.1.63155 WP_000284051.1.63169 WP_000284051.1.63181 WP_000284051.1.63186 WP_000284051.1.63203 WP_000284051.1.63229 WP_000284051.1.63234 WP_000284051.1.63243 WP_000284051.1.63250 WP_000284051.1.63256 WP_000284051.1.63290 WP_000284051.1.63297 WP_000284051.1.63382 WP_000284051.1.63422 WP_000284051.1.63432 WP_000284051.1.63448 WP_000284051.1.63455 WP_000284051.1.63461 WP_000284051.1.63479 WP_000284051.1.63497 WP_000284051.1.63499 WP_000284051.1.63509 WP_000284051.1.63513 WP_000284051.1.63514 WP_000284051.1.63525 WP_000284051.1.63529 WP_000284051.1.63532 WP_000284051.1.63568 WP_000284051.1.6357 WP_000284051.1.63577 WP_000284051.1.63583 WP_000284051.1.63585 WP_000284051.1.63592 WP_000284051.1.63603 WP_000284051.1.63633 WP_000284051.1.63663 WP_000284051.1.63664 WP_000284051.1.6367 WP_000284051.1.63677 WP_000284051.1.63690 WP_000284051.1.6370 WP_000284051.1.63718 WP_000284051.1.63731 WP_000284051.1.63736 WP_000284051.1.63748 WP_000284051.1.6375 WP_000284051.1.63757 WP_000284051.1.63766 WP_000284051.1.63781 WP_000284051.1.63782 WP_000284051.1.63797 WP_000284051.1.63816 WP_000284051.1.63824 WP_000284051.1.63831 WP_000284051.1.63834 WP_000284051.1.6384 WP_000284051.1.63851 WP_000284051.1.63860 WP_000284051.1.63863 WP_000284051.1.63864 WP_000284051.1.63866 WP_000284051.1.63876 WP_000284051.1.6389 WP_000284051.1.63901 WP_000284051.1.63903 WP_000284051.1.63912 WP_000284051.1.63934 WP_000284051.1.63955 WP_000284051.1.63958 WP_000284051.1.63963 WP_000284051.1.63977 WP_000284051.1.6399 WP_000284051.1.63992 WP_000284051.1.64007 WP_000284051.1.64010 WP_000284051.1.64018 WP_000284051.1.64032 WP_000284051.1.64034 WP_000284051.1.64046 WP_000284051.1.64072 WP_000284051.1.64085 WP_000284051.1.64087 WP_000284051.1.64103 WP_000284051.1.64109 WP_000284051.1.6415 WP_000284051.1.64157 WP_000284051.1.64176 WP_000284051.1.64208 WP_000284051.1.64217 WP_000284051.1.64229 WP_000284051.1.6423 WP_000284051.1.64242 WP_000284051.1.64244 WP_000284051.1.64266 WP_000284051.1.64293 WP_000284051.1.64294 WP_000284051.1.64332 WP_000284051.1.64350 WP_000284051.1.6437 WP_000284051.1.64374 WP_000284051.1.64376 WP_000284051.1.64385 WP_000284051.1.64387 WP_000284051.1.64389 WP_000284051.1.644 WP_000284051.1.64403 WP_000284051.1.64462 WP_000284051.1.64471 WP_000284051.1.64500 WP_000284051.1.6451 WP_000284051.1.64538 WP_000284051.1.64569 WP_000284051.1.64597 WP_000284051.1.64632 WP_000284051.1.64645 WP_000284051.1.64648 WP_000284051.1.64649 WP_000284051.1.64654 WP_000284051.1.64662 WP_000284051.1.64663 WP_000284051.1.64667 WP_000284051.1.64674 WP_000284051.1.64690 WP_000284051.1.64702 WP_000284051.1.64709 WP_000284051.1.64710 WP_000284051.1.64711 WP_000284051.1.64721 WP_000284051.1.64744 WP_000284051.1.64757 WP_000284051.1.64758 WP_000284051.1.64763 WP_000284051.1.64771 WP_000284051.1.64781 WP_000284051.1.64798 WP_000284051.1.64817 WP_000284051.1.64831 WP_000284051.1.6484 WP_000284051.1.64847 WP_000284051.1.6487 WP_000284051.1.6489 WP_000284051.1.64891 WP_000284051.1.64894 WP_000284051.1.64919 WP_000284051.1.64920 WP_000284051.1.64944 WP_000284051.1.64972 WP_000284051.1.64974 WP_000284051.1.64977 WP_000284051.1.65011 WP_000284051.1.65016 WP_000284051.1.65018 WP_000284051.1.65022 WP_000284051.1.65027 WP_000284051.1.65028 WP_000284051.1.65052 WP_000284051.1.65054 WP_000284051.1.65075 WP_000284051.1.6514 WP_000284051.1.65163 WP_000284051.1.65168 WP_000284051.1.65171 WP_000284051.1.65172 WP_000284051.1.65185 WP_000284051.1.65191 WP_000284051.1.65200 WP_000284051.1.65211 WP_000284051.1.65218 WP_000284051.1.65226 WP_000284051.1.65238 WP_000284051.1.65248 WP_000284051.1.65249 WP_000284051.1.6525 WP_000284051.1.65266 WP_000284051.1.65269 WP_000284051.1.65295 WP_000284051.1.65348 WP_000284051.1.6535 WP_000284051.1.65357 WP_000284051.1.65363 WP_000284051.1.65394 WP_000284051.1.65395 WP_000284051.1.65437 WP_000284051.1.65459 WP_000284051.1.65463 WP_000284051.1.65471 WP_000284051.1.65474 WP_000284051.1.65475 WP_000284051.1.65487 WP_000284051.1.6549 WP_000284051.1.65499 WP_000284051.1.6550 WP_000284051.1.65508 WP_000284051.1.65538 WP_000284051.1.6554 WP_000284051.1.65558 WP_000284051.1.65572 WP_000284051.1.6558 WP_000284051.1.6560 WP_000284051.1.65601 WP_000284051.1.6561 WP_000284051.1.65620 WP_000284051.1.65633 WP_000284051.1.6565 WP_000284051.1.65650 WP_000284051.1.65687 WP_000284051.1.65696 WP_000284051.1.65697 WP_000284051.1.65698 WP_000284051.1.65699 WP_000284051.1.6572 WP_000284051.1.65737 WP_000284051.1.6575 WP_000284051.1.65755 WP_000284051.1.65771 WP_000284051.1.65782 WP_000284051.1.65790 WP_000284051.1.65795 WP_000284051.1.65812 WP_000284051.1.65818 WP_000284051.1.65838 WP_000284051.1.65846 WP_000284051.1.65849 WP_000284051.1.65863 WP_000284051.1.65876 WP_000284051.1.65881 WP_000284051.1.65883 WP_000284051.1.65901 WP_000284051.1.65940 WP_000284051.1.65945 WP_000284051.1.6595 WP_000284051.1.65956 WP_000284051.1.65968 WP_000284051.1.65985 WP_000284051.1.66021 WP_000284051.1.66031 WP_000284051.1.66049 WP_000284051.1.66052 WP_000284051.1.66064 WP_000284051.1.66074 WP_000284051.1.66082 WP_000284051.1.66085 WP_000284051.1.66109 WP_000284051.1.66129 WP_000284051.1.66145 WP_000284051.1.66167 WP_000284051.1.66171 WP_000284051.1.66183 WP_000284051.1.6620 WP_000284051.1.66216 WP_000284051.1.66234 WP_000284051.1.66235 WP_000284051.1.66250 WP_000284051.1.66270 WP_000284051.1.66272 WP_000284051.1.66273 WP_000284051.1.6630 WP_000284051.1.66314 WP_000284051.1.66315 WP_000284051.1.66324 WP_000284051.1.66330 WP_000284051.1.6634 WP_000284051.1.66358 WP_000284051.1.66361 WP_000284051.1.66362 WP_000284051.1.66365 WP_000284051.1.66368 WP_000284051.1.6638 WP_000284051.1.66385 WP_000284051.1.6640 WP_000284051.1.66400 WP_000284051.1.66428 WP_000284051.1.66446 WP_000284051.1.66462 WP_000284051.1.6647 WP_000284051.1.66480 WP_000284051.1.66492 WP_000284051.1.66506 WP_000284051.1.66534 WP_000284051.1.66539 WP_000284051.1.66600 WP_000284051.1.66630 WP_000284051.1.66665 WP_000284051.1.66678 WP_000284051.1.66681 WP_000284051.1.66684 WP_000284051.1.66698 WP_000284051.1.66702 WP_000284051.1.66733 WP_000284051.1.66755 WP_000284051.1.66759 WP_000284051.1.66779 WP_000284051.1.6680 WP_000284051.1.66800 WP_000284051.1.66801 WP_000284051.1.66807 WP_000284051.1.66820 WP_000284051.1.66824 WP_000284051.1.66825 WP_000284051.1.66834 WP_000284051.1.66860 WP_000284051.1.66876 WP_000284051.1.66901 WP_000284051.1.6692 WP_000284051.1.66953 WP_000284051.1.66955 WP_000284051.1.66959 WP_000284051.1.66962 WP_000284051.1.66981 WP_000284051.1.67 WP_000284051.1.67024 WP_000284051.1.67037 WP_000284051.1.67042 WP_000284051.1.67045 WP_000284051.1.67075 WP_000284051.1.6710 WP_000284051.1.67100 WP_000284051.1.67101 WP_000284051.1.67143 WP_000284051.1.67173 WP_000284051.1.67175 WP_000284051.1.67181 WP_000284051.1.67184 WP_000284051.1.67201 WP_000284051.1.67211 WP_000284051.1.67228 WP_000284051.1.67235 WP_000284051.1.67237 WP_000284051.1.67268 WP_000284051.1.67279 WP_000284051.1.67288 WP_000284051.1.67336 WP_000284051.1.67339 WP_000284051.1.67347 WP_000284051.1.67374 WP_000284051.1.67387 WP_000284051.1.6739 WP_000284051.1.67394 WP_000284051.1.67397 WP_000284051.1.67403 WP_000284051.1.67405 WP_000284051.1.67424 WP_000284051.1.67430 WP_000284051.1.67442 WP_000284051.1.67465 WP_000284051.1.67539 WP_000284051.1.67552 WP_000284051.1.67556 WP_000284051.1.67576 WP_000284051.1.6760 WP_000284051.1.67603 WP_000284051.1.67604 WP_000284051.1.67617 WP_000284051.1.67619 WP_000284051.1.67623 WP_000284051.1.67625 WP_000284051.1.67627 WP_000284051.1.67633 WP_000284051.1.67641 WP_000284051.1.67657 WP_000284051.1.67673 WP_000284051.1.67682 WP_000284051.1.67700 WP_000284051.1.67705 WP_000284051.1.67707 WP_000284051.1.67718 WP_000284051.1.67729 WP_000284051.1.67731 WP_000284051.1.67772 WP_000284051.1.67774 WP_000284051.1.67776 WP_000284051.1.67803 WP_000284051.1.67814 WP_000284051.1.6782 WP_000284051.1.67820 WP_000284051.1.67825 WP_000284051.1.67827 WP_000284051.1.67829 WP_000284051.1.6785 WP_000284051.1.67887 WP_000284051.1.67905 WP_000284051.1.67910 WP_000284051.1.67924 WP_000284051.1.67932 WP_000284051.1.67942 WP_000284051.1.67954 WP_000284051.1.67969 WP_000284051.1.67970 WP_000284051.1.67977 WP_000284051.1.67988 WP_000284051.1.68 WP_000284051.1.68036 WP_000284051.1.68043 WP_000284051.1.68073 WP_000284051.1.68075 WP_000284051.1.6809 WP_000284051.1.68105 WP_000284051.1.68113 WP_000284051.1.68115 WP_000284051.1.68131 WP_000284051.1.68140 WP_000284051.1.68147 WP_000284051.1.68159 WP_000284051.1.68167 WP_000284051.1.68182 WP_000284051.1.6819 WP_000284051.1.68201 WP_000284051.1.68206 WP_000284051.1.68210 WP_000284051.1.6827 WP_000284051.1.68275 WP_000284051.1.68285 WP_000284051.1.6833 WP_000284051.1.68359 WP_000284051.1.68401 WP_000284051.1.68420 WP_000284051.1.68477 WP_000284051.1.68478 WP_000284051.1.6849 WP_000284051.1.685 WP_000284051.1.68514 WP_000284051.1.68532 WP_000284051.1.68547 WP_000284051.1.68564 WP_000284051.1.6857 WP_000284051.1.6858 WP_000284051.1.68589 WP_000284051.1.68591 WP_000284051.1.68629 WP_000284051.1.68652 WP_000284051.1.68655 WP_000284051.1.68656 WP_000284051.1.68658 WP_000284051.1.68677 WP_000284051.1.68688 WP_000284051.1.6869 WP_000284051.1.68690 WP_000284051.1.68742 WP_000284051.1.6875 WP_000284051.1.68770 WP_000284051.1.68778 WP_000284051.1.68787 WP_000284051.1.6879 WP_000284051.1.68809 WP_000284051.1.68816 WP_000284051.1.68818 WP_000284051.1.6882 WP_000284051.1.6883 WP_000284051.1.68893 WP_000284051.1.68894 WP_000284051.1.68895 WP_000284051.1.68914 WP_000284051.1.68928 WP_000284051.1.68958 WP_000284051.1.68966 WP_000284051.1.68975 WP_000284051.1.68999 WP_000284051.1.69001 WP_000284051.1.69006 WP_000284051.1.69011 WP_000284051.1.69029 WP_000284051.1.6904 WP_000284051.1.69042 WP_000284051.1.6905 WP_000284051.1.69053 WP_000284051.1.69058 WP_000284051.1.6907 WP_000284051.1.69080 WP_000284051.1.69086 WP_000284051.1.6913 WP_000284051.1.69131 WP_000284051.1.69139 WP_000284051.1.69146 WP_000284051.1.69151 WP_000284051.1.69170 WP_000284051.1.69210 WP_000284051.1.69236 WP_000284051.1.69255 WP_000284051.1.69270 WP_000284051.1.69273 WP_000284051.1.69282 WP_000284051.1.69288 WP_000284051.1.69296 WP_000284051.1.69320 WP_000284051.1.69346 WP_000284051.1.69357 WP_000284051.1.69359 WP_000284051.1.69371 WP_000284051.1.69376 WP_000284051.1.69385 WP_000284051.1.69396 WP_000284051.1.69397 WP_000284051.1.69433 WP_000284051.1.69465 WP_000284051.1.69466 WP_000284051.1.69485 WP_000284051.1.69515 WP_000284051.1.6954 WP_000284051.1.69554 WP_000284051.1.69564 WP_000284051.1.69575 WP_000284051.1.69588 WP_000284051.1.69592 WP_000284051.1.69597 WP_000284051.1.69611 WP_000284051.1.69616 WP_000284051.1.69636 WP_000284051.1.69642 WP_000284051.1.69644 WP_000284051.1.69656 WP_000284051.1.69657 WP_000284051.1.69690 WP_000284051.1.69696 WP_000284051.1.69704 WP_000284051.1.69710 WP_000284051.1.69754 WP_000284051.1.69758 WP_000284051.1.69760 WP_000284051.1.69767 WP_000284051.1.69785 WP_000284051.1.69787 WP_000284051.1.69790 WP_000284051.1.69807 WP_000284051.1.69808 WP_000284051.1.69817 WP_000284051.1.69839 WP_000284051.1.69848 WP_000284051.1.69890 WP_000284051.1.69923 WP_000284051.1.69948 WP_000284051.1.69953 WP_000284051.1.69965 WP_000284051.1.69975 WP_000284051.1.69977 WP_000284051.1.69982 WP_000284051.1.70003 WP_000284051.1.70010 WP_000284051.1.70028 WP_000284051.1.70047 WP_000284051.1.70049 WP_000284051.1.70058 WP_000284051.1.70061 WP_000284051.1.70087 WP_000284051.1.70088 WP_000284051.1.7010 WP_000284051.1.7014 WP_000284051.1.7016 WP_000284051.1.70169 WP_000284051.1.70183 WP_000284051.1.70205 WP_000284051.1.7021 WP_000284051.1.70240 WP_000284051.1.70241 WP_000284051.1.70248 WP_000284051.1.70249 WP_000284051.1.70261 WP_000284051.1.70269 WP_000284051.1.70272 WP_000284051.1.70281 WP_000284051.1.70289 WP_000284051.1.70290 WP_000284051.1.70314 WP_000284051.1.70321 WP_000284051.1.70326 WP_000284051.1.70327 WP_000284051.1.7033 WP_000284051.1.70355 WP_000284051.1.70394 WP_000284051.1.70427 WP_000284051.1.70433 WP_000284051.1.7044 WP_000284051.1.70440 WP_000284051.1.70447 WP_000284051.1.70485 WP_000284051.1.70488 WP_000284051.1.70491 WP_000284051.1.70523 WP_000284051.1.70531 WP_000284051.1.70545 WP_000284051.1.70547 WP_000284051.1.7055 WP_000284051.1.70580 WP_000284051.1.70596 WP_000284051.1.7060 WP_000284051.1.70623 WP_000284051.1.70643 WP_000284051.1.70644 WP_000284051.1.70662 WP_000284051.1.70671 WP_000284051.1.70678 WP_000284051.1.70679 WP_000284051.1.70683 WP_000284051.1.70685 WP_000284051.1.70708 WP_000284051.1.70712 WP_000284051.1.70717 WP_000284051.1.70731 WP_000284051.1.70732 WP_000284051.1.70733 WP_000284051.1.70761 WP_000284051.1.70772 WP_000284051.1.70785 WP_000284051.1.70792 WP_000284051.1.70797 WP_000284051.1.70837 WP_000284051.1.70845 WP_000284051.1.70846 WP_000284051.1.70869 WP_000284051.1.70883 WP_000284051.1.70899 WP_000284051.1.70914 WP_000284051.1.70922 WP_000284051.1.7093 WP_000284051.1.70948 WP_000284051.1.70959 WP_000284051.1.70969 WP_000284051.1.70971 WP_000284051.1.70981 WP_000284051.1.70985 WP_000284051.1.70986 WP_000284051.1.70995 WP_000284051.1.71007 WP_000284051.1.71010 WP_000284051.1.71023 WP_000284051.1.71039 WP_000284051.1.71057 WP_000284051.1.71069 WP_000284051.1.71081 WP_000284051.1.71088 WP_000284051.1.7110 WP_000284051.1.71116 WP_000284051.1.71117 WP_000284051.1.71120 WP_000284051.1.71146 WP_000284051.1.71150 WP_000284051.1.71165 WP_000284051.1.71171 WP_000284051.1.71172 WP_000284051.1.71184 WP_000284051.1.71186 WP_000284051.1.71188 WP_000284051.1.71201 WP_000284051.1.71202 WP_000284051.1.71243 WP_000284051.1.71245 WP_000284051.1.71248 WP_000284051.1.71268 WP_000284051.1.71299 WP_000284051.1.71305 WP_000284051.1.71306 WP_000284051.1.71337 WP_000284051.1.7134 WP_000284051.1.71363 WP_000284051.1.71368 WP_000284051.1.71378 WP_000284051.1.714 WP_000284051.1.71401 WP_000284051.1.71407 WP_000284051.1.71418 WP_000284051.1.7142 WP_000284051.1.71446 WP_000284051.1.71450 WP_000284051.1.71452 WP_000284051.1.71455 WP_000284051.1.71456 WP_000284051.1.71481 WP_000284051.1.71487 WP_000284051.1.71500 WP_000284051.1.71523 WP_000284051.1.71542 WP_000284051.1.71566 WP_000284051.1.71583 WP_000284051.1.71626 WP_000284051.1.71636 WP_000284051.1.71640 WP_000284051.1.71649 WP_000284051.1.71651 WP_000284051.1.71653 WP_000284051.1.71656 WP_000284051.1.71658 WP_000284051.1.71667 WP_000284051.1.71691 WP_000284051.1.71702 WP_000284051.1.71716 WP_000284051.1.7174 WP_000284051.1.71746 WP_000284051.1.71750 WP_000284051.1.71756 WP_000284051.1.71793 WP_000284051.1.71798 WP_000284051.1.71845 WP_000284051.1.71848 WP_000284051.1.71872 WP_000284051.1.71881 WP_000284051.1.71908 WP_000284051.1.71923 WP_000284051.1.71929 WP_000284051.1.71941 WP_000284051.1.71950 WP_000284051.1.71952 WP_000284051.1.71954 WP_000284051.1.71973 WP_000284051.1.71979 WP_000284051.1.71984 WP_000284051.1.71985 WP_000284051.1.720 WP_000284051.1.72003 WP_000284051.1.72065 WP_000284051.1.72068 WP_000284051.1.72073 WP_000284051.1.72100 WP_000284051.1.72105 WP_000284051.1.72107 WP_000284051.1.72119 WP_000284051.1.72121 WP_000284051.1.72188 WP_000284051.1.72190 WP_000284051.1.72203 WP_000284051.1.72220 WP_000284051.1.72221 WP_000284051.1.72226 WP_000284051.1.72234 WP_000284051.1.72243 WP_000284051.1.72254 WP_000284051.1.72269 WP_000284051.1.72277 WP_000284051.1.72281 WP_000284051.1.72283 WP_000284051.1.72300 WP_000284051.1.72307 WP_000284051.1.72325 WP_000284051.1.72339 WP_000284051.1.72350 WP_000284051.1.72351 WP_000284051.1.72372 WP_000284051.1.72376 WP_000284051.1.72382 WP_000284051.1.72383 WP_000284051.1.72399 WP_000284051.1.72403 WP_000284051.1.72412 WP_000284051.1.7243 WP_000284051.1.72438 WP_000284051.1.72461 WP_000284051.1.72527 WP_000284051.1.72532 WP_000284051.1.7255 WP_000284051.1.72594 WP_000284051.1.72602 WP_000284051.1.72629 WP_000284051.1.72631 WP_000284051.1.72638 WP_000284051.1.72642 WP_000284051.1.72667 WP_000284051.1.72671 WP_000284051.1.72674 WP_000284051.1.72689 WP_000284051.1.72716 WP_000284051.1.72718 WP_000284051.1.72724 WP_000284051.1.72728 WP_000284051.1.72789 WP_000284051.1.72793 WP_000284051.1.72797 WP_000284051.1.72827 WP_000284051.1.72828 WP_000284051.1.72843 WP_000284051.1.72850 WP_000284051.1.72865 WP_000284051.1.72871 WP_000284051.1.72872 WP_000284051.1.72887 WP_000284051.1.72892 WP_000284051.1.72894 WP_000284051.1.72896 WP_000284051.1.72897 WP_000284051.1.72944 WP_000284051.1.72946 WP_000284051.1.7295 WP_000284051.1.72968 WP_000284051.1.72969 WP_000284051.1.72975 WP_000284051.1.72987 WP_000284051.1.7304 WP_000284051.1.73052 WP_000284051.1.73062 WP_000284051.1.73068 WP_000284051.1.73102 WP_000284051.1.7311 WP_000284051.1.73114 WP_000284051.1.73125 WP_000284051.1.73144 WP_000284051.1.7315 WP_000284051.1.7316 WP_000284051.1.73164 WP_000284051.1.73177 WP_000284051.1.73180 WP_000284051.1.73200 WP_000284051.1.73258 WP_000284051.1.73285 WP_000284051.1.7332 WP_000284051.1.73328 WP_000284051.1.7333 WP_000284051.1.73338 WP_000284051.1.7334 WP_000284051.1.73352 WP_000284051.1.73362 WP_000284051.1.73377 WP_000284051.1.73379 WP_000284051.1.73389 WP_000284051.1.73425 WP_000284051.1.73461 WP_000284051.1.73481 WP_000284051.1.73488 WP_000284051.1.73504 WP_000284051.1.73512 WP_000284051.1.7353 WP_000284051.1.73535 WP_000284051.1.73544 WP_000284051.1.7356 WP_000284051.1.73561 WP_000284051.1.73581 WP_000284051.1.73596 WP_000284051.1.73598 WP_000284051.1.7361 WP_000284051.1.73617 WP_000284051.1.73648 WP_000284051.1.73667 WP_000284051.1.73669 WP_000284051.1.73701 WP_000284051.1.73708 WP_000284051.1.7374 WP_000284051.1.73753 WP_000284051.1.73758 WP_000284051.1.73768 WP_000284051.1.73794 WP_000284051.1.73804 WP_000284051.1.73831 WP_000284051.1.73847 WP_000284051.1.73849 WP_000284051.1.7386 WP_000284051.1.7387 WP_000284051.1.73901 WP_000284051.1.73924 WP_000284051.1.73926 WP_000284051.1.7394 WP_000284051.1.73945 WP_000284051.1.73948 WP_000284051.1.73956 WP_000284051.1.73958 WP_000284051.1.73965 WP_000284051.1.73999 WP_000284051.1.74024 WP_000284051.1.74028 WP_000284051.1.74029 WP_000284051.1.74030 WP_000284051.1.74038 WP_000284051.1.74040 WP_000284051.1.74043 WP_000284051.1.74049 WP_000284051.1.7405 WP_000284051.1.74058 WP_000284051.1.74070 WP_000284051.1.74077 WP_000284051.1.74089 WP_000284051.1.74117 WP_000284051.1.74135 WP_000284051.1.74163 WP_000284051.1.74174 WP_000284051.1.74181 WP_000284051.1.74191 WP_000284051.1.74207 WP_000284051.1.74214 WP_000284051.1.74228 WP_000284051.1.74241 WP_000284051.1.74248 WP_000284051.1.74285 WP_000284051.1.743 WP_000284051.1.7430 WP_000284051.1.74300 WP_000284051.1.74317 WP_000284051.1.7433 WP_000284051.1.74379 WP_000284051.1.74402 WP_000284051.1.74410 WP_000284051.1.74414 WP_000284051.1.74415 WP_000284051.1.74418 WP_000284051.1.74422 WP_000284051.1.74428 WP_000284051.1.7444 WP_000284051.1.74454 WP_000284051.1.74466 WP_000284051.1.74469 WP_000284051.1.74481 WP_000284051.1.745 WP_000284051.1.74500 WP_000284051.1.74529 WP_000284051.1.74570 WP_000284051.1.74578 WP_000284051.1.7458 WP_000284051.1.74616 WP_000284051.1.74620 WP_000284051.1.74621 WP_000284051.1.74632 WP_000284051.1.74639 WP_000284051.1.74644 WP_000284051.1.74647 WP_000284051.1.74661 WP_000284051.1.74677 WP_000284051.1.74699 WP_000284051.1.74702 WP_000284051.1.74741 WP_000284051.1.74745 WP_000284051.1.74757 WP_000284051.1.74806 WP_000284051.1.74807 WP_000284051.1.74826 WP_000284051.1.74831 WP_000284051.1.74876 WP_000284051.1.74884 WP_000284051.1.74894 WP_000284051.1.7491 WP_000284051.1.74929 WP_000284051.1.74939 WP_000284051.1.74946 WP_000284051.1.74972 WP_000284051.1.74973 WP_000284051.1.74992 WP_000284051.1.74996 WP_000284051.1.75009 WP_000284051.1.75051 WP_000284051.1.75056 WP_000284051.1.75058 WP_000284051.1.7507 WP_000284051.1.75089 WP_000284051.1.75114 WP_000284051.1.75116 WP_000284051.1.75129 WP_000284051.1.75134 WP_000284051.1.75148 WP_000284051.1.75159 WP_000284051.1.75168 WP_000284051.1.75177 WP_000284051.1.75180 WP_000284051.1.75187 WP_000284051.1.75237 WP_000284051.1.75273 WP_000284051.1.75288 WP_000284051.1.75296 WP_000284051.1.75301 WP_000284051.1.7531 WP_000284051.1.75334 WP_000284051.1.75362 WP_000284051.1.75371 WP_000284051.1.75385 WP_000284051.1.75392 WP_000284051.1.75400 WP_000284051.1.75402 WP_000284051.1.75413 WP_000284051.1.7543 WP_000284051.1.75433 WP_000284051.1.75450 WP_000284051.1.75494 WP_000284051.1.75532 WP_000284051.1.75565 WP_000284051.1.7558 WP_000284051.1.75585 WP_000284051.1.75593 WP_000284051.1.75607 WP_000284051.1.75609 WP_000284051.1.75610 WP_000284051.1.75626 WP_000284051.1.7563 WP_000284051.1.75633 WP_000284051.1.75664 WP_000284051.1.75703 WP_000284051.1.75716 WP_000284051.1.75718 WP_000284051.1.75740 WP_000284051.1.75745 WP_000284051.1.75751 WP_000284051.1.75760 WP_000284051.1.75764 WP_000284051.1.75793 WP_000284051.1.75794 WP_000284051.1.75810 WP_000284051.1.75828 WP_000284051.1.75837 WP_000284051.1.75844 WP_000284051.1.75863 WP_000284051.1.75873 WP_000284051.1.75874 WP_000284051.1.75884 WP_000284051.1.75886 WP_000284051.1.75898 WP_000284051.1.75902 WP_000284051.1.75919 WP_000284051.1.75932 WP_000284051.1.75945 WP_000284051.1.75957 WP_000284051.1.75997 WP_000284051.1.76 WP_000284051.1.76020 WP_000284051.1.76024 WP_000284051.1.76055 WP_000284051.1.76081 WP_000284051.1.76097 WP_000284051.1.76102 WP_000284051.1.76108 WP_000284051.1.76115 WP_000284051.1.76116 WP_000284051.1.76122 WP_000284051.1.76137 WP_000284051.1.76156 WP_000284051.1.76162 WP_000284051.1.76164 WP_000284051.1.76170 WP_000284051.1.76186 WP_000284051.1.76197 WP_000284051.1.76208 WP_000284051.1.76252 WP_000284051.1.76256 WP_000284051.1.7629 WP_000284051.1.76301 WP_000284051.1.76327 WP_000284051.1.7633 WP_000284051.1.76339 WP_000284051.1.7634 WP_000284051.1.76345 WP_000284051.1.76346 WP_000284051.1.76364 WP_000284051.1.76366 WP_000284051.1.76417 WP_000284051.1.76434 WP_000284051.1.76445 WP_000284051.1.76451 WP_000284051.1.7646 WP_000284051.1.76471 WP_000284051.1.76495 WP_000284051.1.76510 WP_000284051.1.76529 WP_000284051.1.76532 WP_000284051.1.76548 WP_000284051.1.7655 WP_000284051.1.76558 WP_000284051.1.7657 WP_000284051.1.76572 WP_000284051.1.76576 WP_000284051.1.7660 WP_000284051.1.76611 WP_000284051.1.76641 WP_000284051.1.76651 WP_000284051.1.76653 WP_000284051.1.76673 WP_000284051.1.76706 WP_000284051.1.7672 WP_000284051.1.76721 WP_000284051.1.76724 WP_000284051.1.76738 WP_000284051.1.76756 WP_000284051.1.76760 WP_000284051.1.76776 WP_000284051.1.76788 WP_000284051.1.76799 WP_000284051.1.76806 WP_000284051.1.7684 WP_000284051.1.76854 WP_000284051.1.76866 WP_000284051.1.76875 WP_000284051.1.76880 WP_000284051.1.76899 WP_000284051.1.76913 WP_000284051.1.76916 WP_000284051.1.76932 WP_000284051.1.76968 WP_000284051.1.76973 WP_000284051.1.76988 WP_000284051.1.77016 WP_000284051.1.77017 WP_000284051.1.77033 WP_000284051.1.77038 WP_000284051.1.77047 WP_000284051.1.77080 WP_000284051.1.77087 WP_000284051.1.77090 WP_000284051.1.77111 WP_000284051.1.7712 WP_000284051.1.77177 WP_000284051.1.77180 WP_000284051.1.77184 WP_000284051.1.77193 WP_000284051.1.77241 WP_000284051.1.77244 WP_000284051.1.77267 WP_000284051.1.77271 WP_000284051.1.77292 WP_000284051.1.77299 WP_000284051.1.77306 WP_000284051.1.77313 WP_000284051.1.77349 WP_000284051.1.77356 WP_000284051.1.77384 WP_000284051.1.77390 WP_000284051.1.77414 WP_000284051.1.77431 WP_000284051.1.77436 WP_000284051.1.77440 WP_000284051.1.77475 WP_000284051.1.77496 WP_000284051.1.77501 WP_000284051.1.77512 WP_000284051.1.77513 WP_000284051.1.77514 WP_000284051.1.77529 WP_000284051.1.77543 WP_000284051.1.77549 WP_000284051.1.77555 WP_000284051.1.77563 WP_000284051.1.77565 WP_000284051.1.77575 WP_000284051.1.77596 WP_000284051.1.77622 WP_000284051.1.77629 WP_000284051.1.77646 WP_000284051.1.77653 WP_000284051.1.77692 WP_000284051.1.77702 WP_000284051.1.77710 WP_000284051.1.77713 WP_000284051.1.7772 WP_000284051.1.77729 WP_000284051.1.77754 WP_000284051.1.77761 WP_000284051.1.7782 WP_000284051.1.77825 WP_000284051.1.77837 WP_000284051.1.7784 WP_000284051.1.77846 WP_000284051.1.77851 WP_000284051.1.77861 WP_000284051.1.77871 WP_000284051.1.77898 WP_000284051.1.77900 WP_000284051.1.77918 WP_000284051.1.7792 WP_000284051.1.77923 WP_000284051.1.7793 WP_000284051.1.77951 WP_000284051.1.77960 WP_000284051.1.77971 WP_000284051.1.77975 WP_000284051.1.77983 WP_000284051.1.77987 WP_000284051.1.77989 WP_000284051.1.78 WP_000284051.1.78016 WP_000284051.1.7802 WP_000284051.1.78026 WP_000284051.1.78033 WP_000284051.1.78035 WP_000284051.1.78048 WP_000284051.1.78051 WP_000284051.1.78053 WP_000284051.1.78076 WP_000284051.1.78096 WP_000284051.1.78100 WP_000284051.1.78107 WP_000284051.1.78110 WP_000284051.1.78120 WP_000284051.1.7814 WP_000284051.1.78166 WP_000284051.1.78168 WP_000284051.1.78170 WP_000284051.1.78180 WP_000284051.1.78192 WP_000284051.1.78195 WP_000284051.1.78201 WP_000284051.1.78245 WP_000284051.1.78259 WP_000284051.1.78291 WP_000284051.1.78301 WP_000284051.1.78309 WP_000284051.1.78320 WP_000284051.1.78339 WP_000284051.1.78352 WP_000284051.1.78366 WP_000284051.1.78372 WP_000284051.1.78382 WP_000284051.1.78383 WP_000284051.1.78388 WP_000284051.1.78407 WP_000284051.1.78410 WP_000284051.1.78426 WP_000284051.1.78443 WP_000284051.1.78495 WP_000284051.1.78496 WP_000284051.1.78501 WP_000284051.1.78502 WP_000284051.1.78602 WP_000284051.1.78603 WP_000284051.1.7861 WP_000284051.1.78618 WP_000284051.1.7862 WP_000284051.1.78626 WP_000284051.1.78632 WP_000284051.1.78658 WP_000284051.1.78661 WP_000284051.1.78673 WP_000284051.1.78674 WP_000284051.1.78676 WP_000284051.1.78715 WP_000284051.1.78734 WP_000284051.1.78735 WP_000284051.1.78738 WP_000284051.1.78761 WP_000284051.1.7877 WP_000284051.1.78771 WP_000284051.1.78789 WP_000284051.1.78802 WP_000284051.1.78815 WP_000284051.1.78830 WP_000284051.1.78835 WP_000284051.1.78838 WP_000284051.1.78862 WP_000284051.1.78871 WP_000284051.1.78874 WP_000284051.1.78877 WP_000284051.1.78881 WP_000284051.1.78896 WP_000284051.1.789 WP_000284051.1.7891 WP_000284051.1.78913 WP_000284051.1.78918 WP_000284051.1.78928 WP_000284051.1.7893 WP_000284051.1.78930 WP_000284051.1.78951 WP_000284051.1.78959 WP_000284051.1.78993 WP_000284051.1.79011 WP_000284051.1.79012 WP_000284051.1.79032 WP_000284051.1.79069 WP_000284051.1.79074 WP_000284051.1.79081 WP_000284051.1.79098 WP_000284051.1.79099 WP_000284051.1.79140 WP_000284051.1.79151 WP_000284051.1.79155 WP_000284051.1.79164 WP_000284051.1.79167 WP_000284051.1.79189 WP_000284051.1.79203 WP_000284051.1.79204 WP_000284051.1.79235 WP_000284051.1.79280 WP_000284051.1.79289 WP_000284051.1.79297 WP_000284051.1.79300 WP_000284051.1.79302 WP_000284051.1.79335 WP_000284051.1.79370 WP_000284051.1.79397 WP_000284051.1.794 WP_000284051.1.79427 WP_000284051.1.79456 WP_000284051.1.79462 WP_000284051.1.79466 WP_000284051.1.79468 WP_000284051.1.79472 WP_000284051.1.79490 WP_000284051.1.79495 WP_000284051.1.79529 WP_000284051.1.79531 WP_000284051.1.79532 WP_000284051.1.79547 WP_000284051.1.7956 WP_000284051.1.79570 WP_000284051.1.79580 WP_000284051.1.79586 WP_000284051.1.79635 WP_000284051.1.7964 WP_000284051.1.79642 WP_000284051.1.79645 WP_000284051.1.79654 WP_000284051.1.79659 WP_000284051.1.79668 WP_000284051.1.7970 WP_000284051.1.79708 WP_000284051.1.7972 WP_000284051.1.79722 WP_000284051.1.79734 WP_000284051.1.79738 WP_000284051.1.79772 WP_000284051.1.79778 WP_000284051.1.7979 WP_000284051.1.7982 WP_000284051.1.79832 WP_000284051.1.79842 WP_000284051.1.79845 WP_000284051.1.79867 WP_000284051.1.79880 WP_000284051.1.79892 WP_000284051.1.7991 WP_000284051.1.79910 WP_000284051.1.79914 WP_000284051.1.79916 WP_000284051.1.79929 WP_000284051.1.79934 WP_000284051.1.7994 WP_000284051.1.79942 WP_000284051.1.79945 WP_000284051.1.79951 WP_000284051.1.79966 WP_000284051.1.79974 WP_000284051.1.79977 WP_000284051.1.79996 WP_000284051.1.80065 WP_000284051.1.80077 WP_000284051.1.80103 WP_000284051.1.80137 WP_000284051.1.80149 WP_000284051.1.80157 WP_000284051.1.80182 WP_000284051.1.80229 WP_000284051.1.80236 WP_000284051.1.8024 WP_000284051.1.80249 WP_000284051.1.80250 WP_000284051.1.80254 WP_000284051.1.80273 WP_000284051.1.80282 WP_000284051.1.80293 WP_000284051.1.80296 WP_000284051.1.80307 WP_000284051.1.80333 WP_000284051.1.80354 WP_000284051.1.80366 WP_000284051.1.80368 WP_000284051.1.80380 WP_000284051.1.80386 WP_000284051.1.80400 WP_000284051.1.80441 WP_000284051.1.80443 WP_000284051.1.80448 WP_000284051.1.80462 WP_000284051.1.80473 WP_000284051.1.80479 WP_000284051.1.80480 WP_000284051.1.8049 WP_000284051.1.80492 WP_000284051.1.80496 WP_000284051.1.80529 WP_000284051.1.80542 WP_000284051.1.80569 WP_000284051.1.80586 WP_000284051.1.80629 WP_000284051.1.80638 WP_000284051.1.80651 WP_000284051.1.80664 WP_000284051.1.80667 WP_000284051.1.80674 WP_000284051.1.80696 WP_000284051.1.80705 WP_000284051.1.80707 WP_000284051.1.80723 WP_000284051.1.80725 WP_000284051.1.80741 WP_000284051.1.80750 WP_000284051.1.80757 WP_000284051.1.80760 WP_000284051.1.80780 WP_000284051.1.80803 WP_000284051.1.80819 WP_000284051.1.80827 WP_000284051.1.80831 WP_000284051.1.80840 WP_000284051.1.80850 WP_000284051.1.80857 WP_000284051.1.80868 WP_000284051.1.80874 WP_000284051.1.80876 WP_000284051.1.80881 WP_000284051.1.80913 WP_000284051.1.80927 WP_000284051.1.80939 WP_000284051.1.80941 WP_000284051.1.80959 WP_000284051.1.8096 WP_000284051.1.80973 WP_000284051.1.80984 WP_000284051.1.81037 WP_000284051.1.81041 WP_000284051.1.8106 WP_000284051.1.81062 WP_000284051.1.81067 WP_000284051.1.81069 WP_000284051.1.81084 WP_000284051.1.81107 WP_000284051.1.81109 WP_000284051.1.81110 WP_000284051.1.81118 WP_000284051.1.81131 WP_000284051.1.81149 WP_000284051.1.81175 WP_000284051.1.81187 WP_000284051.1.8119 WP_000284051.1.81193 WP_000284051.1.81197 WP_000284051.1.81225 WP_000284051.1.81231 WP_000284051.1.81262 WP_000284051.1.81268 WP_000284051.1.81269 WP_000284051.1.8127 WP_000284051.1.81271 WP_000284051.1.81275 WP_000284051.1.8130 WP_000284051.1.81302 WP_000284051.1.81305 WP_000284051.1.8131 WP_000284051.1.81320 WP_000284051.1.81321 WP_000284051.1.81328 WP_000284051.1.81333 WP_000284051.1.8134 WP_000284051.1.81342 WP_000284051.1.81354 WP_000284051.1.81364 WP_000284051.1.81388 WP_000284051.1.81404 WP_000284051.1.81409 WP_000284051.1.81410 WP_000284051.1.81425 WP_000284051.1.81472 WP_000284051.1.81494 WP_000284051.1.81504 WP_000284051.1.81528 WP_000284051.1.81548 WP_000284051.1.81557 WP_000284051.1.81568 WP_000284051.1.81635 WP_000284051.1.81667 WP_000284051.1.81668 WP_000284051.1.81676 WP_000284051.1.8168 WP_000284051.1.81681 WP_000284051.1.8170 WP_000284051.1.81727 WP_000284051.1.81735 WP_000284051.1.81736 WP_000284051.1.81743 WP_000284051.1.81746 WP_000284051.1.81750 WP_000284051.1.81760 WP_000284051.1.81763 WP_000284051.1.81768 WP_000284051.1.81785 WP_000284051.1.81795 WP_000284051.1.81798 WP_000284051.1.81855 WP_000284051.1.81902 WP_000284051.1.81921 WP_000284051.1.81931 WP_000284051.1.81936 WP_000284051.1.81941 WP_000284051.1.81949 WP_000284051.1.8196 WP_000284051.1.81965 WP_000284051.1.81974 WP_000284051.1.81977 WP_000284051.1.81995 WP_000284051.1.82037 WP_000284051.1.82070 WP_000284051.1.82076 WP_000284051.1.82099 WP_000284051.1.82131 WP_000284051.1.82132 WP_000284051.1.82141 WP_000284051.1.82144 WP_000284051.1.82149 WP_000284051.1.82156 WP_000284051.1.8218 WP_000284051.1.82180 WP_000284051.1.82192 WP_000284051.1.82201 WP_000284051.1.82214 WP_000284051.1.82225 WP_000284051.1.82232 WP_000284051.1.82258 WP_000284051.1.82269 WP_000284051.1.82337 WP_000284051.1.82347 WP_000284051.1.82352 WP_000284051.1.8236 WP_000284051.1.82369 WP_000284051.1.82395 WP_000284051.1.8240 WP_000284051.1.82401 WP_000284051.1.82408 WP_000284051.1.82416 WP_000284051.1.8242 WP_000284051.1.82420 WP_000284051.1.82434 WP_000284051.1.82456 WP_000284051.1.82464 WP_000284051.1.82465 WP_000284051.1.8247 WP_000284051.1.82473 WP_000284051.1.82474 WP_000284051.1.82479 WP_000284051.1.82503 WP_000284051.1.82515 WP_000284051.1.82529 WP_000284051.1.82530 WP_000284051.1.82553 WP_000284051.1.82562 WP_000284051.1.82569 WP_000284051.1.82570 WP_000284051.1.82584 WP_000284051.1.82636 WP_000284051.1.82637 WP_000284051.1.82646 WP_000284051.1.82648 WP_000284051.1.82670 WP_000284051.1.82676 WP_000284051.1.82692 WP_000284051.1.82731 WP_000284051.1.82761 WP_000284051.1.82763 WP_000284051.1.82812 WP_000284051.1.8282 WP_000284051.1.82841 WP_000284051.1.82843 WP_000284051.1.82850 WP_000284051.1.82865 WP_000284051.1.82867 WP_000284051.1.82872 WP_000284051.1.82886 WP_000284051.1.82895 WP_000284051.1.82899 WP_000284051.1.82908 WP_000284051.1.82937 WP_000284051.1.8294 WP_000284051.1.82944 WP_000284051.1.82946 WP_000284051.1.82956 WP_000284051.1.82959 WP_000284051.1.82964 WP_000284051.1.82992 WP_000284051.1.83005 WP_000284051.1.83006 WP_000284051.1.83007 WP_000284051.1.8304 WP_000284051.1.83061 WP_000284051.1.83092 WP_000284051.1.83119 WP_000284051.1.83128 WP_000284051.1.83139 WP_000284051.1.83163 WP_000284051.1.83180 WP_000284051.1.83204 WP_000284051.1.8322 WP_000284051.1.83221 WP_000284051.1.83229 WP_000284051.1.83235 WP_000284051.1.83247 WP_000284051.1.83252 WP_000284051.1.83258 WP_000284051.1.83280 WP_000284051.1.83290 WP_000284051.1.83301 WP_000284051.1.83305 WP_000284051.1.83331 WP_000284051.1.83333 WP_000284051.1.83354 WP_000284051.1.83356 WP_000284051.1.83360 WP_000284051.1.83365 WP_000284051.1.83378 WP_000284051.1.83382 WP_000284051.1.83388 WP_000284051.1.83407 WP_000284051.1.83413 WP_000284051.1.83491 WP_000284051.1.83510 WP_000284051.1.83516 WP_000284051.1.83523 WP_000284051.1.8354 WP_000284051.1.83558 WP_000284051.1.83572 WP_000284051.1.83598 WP_000284051.1.83650 WP_000284051.1.83651 WP_000284051.1.83657 WP_000284051.1.83677 WP_000284051.1.83710 WP_000284051.1.83721 WP_000284051.1.83739 WP_000284051.1.8375 WP_000284051.1.83759 WP_000284051.1.83760 WP_000284051.1.83806 WP_000284051.1.83838 WP_000284051.1.83854 WP_000284051.1.83897 WP_000284051.1.83923 WP_000284051.1.83960 WP_000284051.1.83979 WP_000284051.1.8399 WP_000284051.1.83994 WP_000284051.1.83995 WP_000284051.1.84 WP_000284051.1.84000 WP_000284051.1.84001 WP_000284051.1.84011 WP_000284051.1.84031 WP_000284051.1.8406 WP_000284051.1.84075 WP_000284051.1.84076 WP_000284051.1.84077 WP_000284051.1.84083 WP_000284051.1.84086 WP_000284051.1.84100 WP_000284051.1.84103 WP_000284051.1.84106 WP_000284051.1.84110 WP_000284051.1.84115 WP_000284051.1.84127 WP_000284051.1.84150 WP_000284051.1.84154 WP_000284051.1.84168 WP_000284051.1.84179 WP_000284051.1.84205 WP_000284051.1.84209 WP_000284051.1.84229 WP_000284051.1.84230 WP_000284051.1.84252 WP_000284051.1.84283 WP_000284051.1.84291 WP_000284051.1.84300 WP_000284051.1.8431 WP_000284051.1.84325 WP_000284051.1.84345 WP_000284051.1.84355 WP_000284051.1.84359 WP_000284051.1.84369 WP_000284051.1.84373 WP_000284051.1.84392 WP_000284051.1.84397 WP_000284051.1.84401 WP_000284051.1.84403 WP_000284051.1.8441 WP_000284051.1.84435 WP_000284051.1.84459 WP_000284051.1.84461 WP_000284051.1.84475 WP_000284051.1.84497 WP_000284051.1.84515 WP_000284051.1.84523 WP_000284051.1.84532 WP_000284051.1.84551 WP_000284051.1.84554 WP_000284051.1.84567 WP_000284051.1.84572 WP_000284051.1.84598 WP_000284051.1.84631 WP_000284051.1.84644 WP_000284051.1.84659 WP_000284051.1.84683 WP_000284051.1.84693 WP_000284051.1.84711 WP_000284051.1.84721 WP_000284051.1.84727 WP_000284051.1.84744 WP_000284051.1.84745 WP_000284051.1.84773 WP_000284051.1.84814 WP_000284051.1.84860 WP_000284051.1.84872 WP_000284051.1.84876 WP_000284051.1.84879 WP_000284051.1.84885 WP_000284051.1.84899 WP_000284051.1.849 WP_000284051.1.84945 WP_000284051.1.84967 WP_000284051.1.8497 WP_000284051.1.84983 WP_000284051.1.850 WP_000284051.1.85004 WP_000284051.1.85014 WP_000284051.1.8502 WP_000284051.1.85031 WP_000284051.1.85039 WP_000284051.1.85040 WP_000284051.1.85079 WP_000284051.1.85094 WP_000284051.1.85120 WP_000284051.1.85126 WP_000284051.1.85134 WP_000284051.1.85147 WP_000284051.1.85153 WP_000284051.1.85178 WP_000284051.1.85180 WP_000284051.1.85190 WP_000284051.1.85192 WP_000284051.1.85217 WP_000284051.1.8526 WP_000284051.1.85271 WP_000284051.1.85273 WP_000284051.1.85301 WP_000284051.1.8533 WP_000284051.1.85338 WP_000284051.1.85339 WP_000284051.1.8537 WP_000284051.1.85408 WP_000284051.1.85433 WP_000284051.1.8545 WP_000284051.1.85456 WP_000284051.1.85469 WP_000284051.1.85481 WP_000284051.1.85483 WP_000284051.1.85511 WP_000284051.1.85512 WP_000284051.1.8552 WP_000284051.1.85541 WP_000284051.1.8556 WP_000284051.1.85568 WP_000284051.1.8557 WP_000284051.1.85606 WP_000284051.1.85615 WP_000284051.1.85617 WP_000284051.1.85635 WP_000284051.1.85646 WP_000284051.1.85654 WP_000284051.1.85663 WP_000284051.1.85665 WP_000284051.1.85669 WP_000284051.1.85671 WP_000284051.1.85672 WP_000284051.1.85675 WP_000284051.1.85688 WP_000284051.1.85703 WP_000284051.1.85723 WP_000284051.1.85728 WP_000284051.1.85742 WP_000284051.1.85746 WP_000284051.1.85759 WP_000284051.1.85777 WP_000284051.1.85780 WP_000284051.1.85784 WP_000284051.1.85791 WP_000284051.1.85797 WP_000284051.1.85811 WP_000284051.1.85854 WP_000284051.1.85855 WP_000284051.1.85864 WP_000284051.1.85886 WP_000284051.1.859 WP_000284051.1.85900 WP_000284051.1.85904 WP_000284051.1.8591 WP_000284051.1.85917 WP_000284051.1.8594 WP_000284051.1.85943 WP_000284051.1.85976 WP_000284051.1.85977 WP_000284051.1.85982 WP_000284051.1.860 WP_000284051.1.86007 WP_000284051.1.86010 WP_000284051.1.86017 WP_000284051.1.86043 WP_000284051.1.8605 WP_000284051.1.86084 WP_000284051.1.86092 WP_000284051.1.8610 WP_000284051.1.86120 WP_000284051.1.86126 WP_000284051.1.86138 WP_000284051.1.8614 WP_000284051.1.86156 WP_000284051.1.86157 WP_000284051.1.8616 WP_000284051.1.86173 WP_000284051.1.86206 WP_000284051.1.86224 WP_000284051.1.86259 WP_000284051.1.86284 WP_000284051.1.86285 WP_000284051.1.86306 WP_000284051.1.86310 WP_000284051.1.86316 WP_000284051.1.86323 WP_000284051.1.86335 WP_000284051.1.86342 WP_000284051.1.86347 WP_000284051.1.86356 WP_000284051.1.86380 WP_000284051.1.86389 WP_000284051.1.8640 WP_000284051.1.8642 WP_000284051.1.86426 WP_000284051.1.86442 WP_000284051.1.86450 WP_000284051.1.86453 WP_000284051.1.86466 WP_000284051.1.86469 WP_000284051.1.8647 WP_000284051.1.86489 WP_000284051.1.86514 WP_000284051.1.86530 WP_000284051.1.86580 WP_000284051.1.86588 WP_000284051.1.86593 WP_000284051.1.86601 WP_000284051.1.86610 WP_000284051.1.86634 WP_000284051.1.86656 WP_000284051.1.86658 WP_000284051.1.86661 WP_000284051.1.86663 WP_000284051.1.86676 WP_000284051.1.86699 WP_000284051.1.8671 WP_000284051.1.8672 WP_000284051.1.86735 WP_000284051.1.86744 WP_000284051.1.86769 WP_000284051.1.86770 WP_000284051.1.8678 WP_000284051.1.86794 WP_000284051.1.86800 WP_000284051.1.86807 WP_000284051.1.86810 WP_000284051.1.86811 WP_000284051.1.86815 WP_000284051.1.8684 WP_000284051.1.86859 WP_000284051.1.86860 WP_000284051.1.86895 WP_000284051.1.86902 WP_000284051.1.86906 WP_000284051.1.8691 WP_000284051.1.86915 WP_000284051.1.86921 WP_000284051.1.86945 WP_000284051.1.86982 WP_000284051.1.86989 WP_000284051.1.87023 WP_000284051.1.87034 WP_000284051.1.87038 WP_000284051.1.87041 WP_000284051.1.87051 WP_000284051.1.87095 WP_000284051.1.87136 WP_000284051.1.87143 WP_000284051.1.87148 WP_000284051.1.87155 WP_000284051.1.87187 WP_000284051.1.87219 WP_000284051.1.8722 WP_000284051.1.87220 WP_000284051.1.87258 WP_000284051.1.87265 WP_000284051.1.87276 WP_000284051.1.87282 WP_000284051.1.87283 WP_000284051.1.87293 WP_000284051.1.87323 WP_000284051.1.8736 WP_000284051.1.87365 WP_000284051.1.87376 WP_000284051.1.87420 WP_000284051.1.87460 WP_000284051.1.87484 WP_000284051.1.87493 WP_000284051.1.87500 WP_000284051.1.87528 WP_000284051.1.87552 WP_000284051.1.87560 WP_000284051.1.87583 WP_000284051.1.87584 WP_000284051.1.8760 WP_000284051.1.87600 WP_000284051.1.87609 WP_000284051.1.87612 WP_000284051.1.87615 WP_000284051.1.87618 WP_000284051.1.87626 WP_000284051.1.87651 WP_000284051.1.87653 WP_000284051.1.87659 WP_000284051.1.8767 WP_000284051.1.87687 WP_000284051.1.87695 WP_000284051.1.87698 WP_000284051.1.87706 WP_000284051.1.87712 WP_000284051.1.87739 WP_000284051.1.87741 WP_000284051.1.87742 WP_000284051.1.87779 WP_000284051.1.87813 WP_000284051.1.87852 WP_000284051.1.87875 WP_000284051.1.87891 WP_000284051.1.87899 WP_000284051.1.87905 WP_000284051.1.8792 WP_000284051.1.87933 WP_000284051.1.87945 WP_000284051.1.87949 WP_000284051.1.87999 WP_000284051.1.8800 WP_000284051.1.88014 WP_000284051.1.88019 WP_000284051.1.88025 WP_000284051.1.88026 WP_000284051.1.8805 WP_000284051.1.88052 WP_000284051.1.8806 WP_000284051.1.88073 WP_000284051.1.8809 WP_000284051.1.88092 WP_000284051.1.881 WP_000284051.1.88136 WP_000284051.1.88145 WP_000284051.1.88165 WP_000284051.1.88174 WP_000284051.1.88185 WP_000284051.1.88199 WP_000284051.1.88214 WP_000284051.1.88222 WP_000284051.1.88244 WP_000284051.1.88264 WP_000284051.1.88275 WP_000284051.1.88291 WP_000284051.1.88293 WP_000284051.1.88299 WP_000284051.1.88303 WP_000284051.1.88313 WP_000284051.1.88356 WP_000284051.1.88359 WP_000284051.1.8837 WP_000284051.1.88393 WP_000284051.1.88407 WP_000284051.1.88414 WP_000284051.1.88423 WP_000284051.1.88444 WP_000284051.1.88446 WP_000284051.1.88458 WP_000284051.1.88474 WP_000284051.1.88483 WP_000284051.1.8849 WP_000284051.1.88501 WP_000284051.1.88508 WP_000284051.1.88538 WP_000284051.1.88547 WP_000284051.1.88597 WP_000284051.1.886 WP_000284051.1.88609 WP_000284051.1.88620 WP_000284051.1.88624 WP_000284051.1.88647 WP_000284051.1.88648 WP_000284051.1.88651 WP_000284051.1.88675 WP_000284051.1.88683 WP_000284051.1.88692 WP_000284051.1.88698 WP_000284051.1.88703 WP_000284051.1.88707 WP_000284051.1.88727 WP_000284051.1.88731 WP_000284051.1.88762 WP_000284051.1.88772 WP_000284051.1.88776 WP_000284051.1.88792 WP_000284051.1.88817 WP_000284051.1.88845 WP_000284051.1.88850 WP_000284051.1.88854 WP_000284051.1.8889 WP_000284051.1.88892 WP_000284051.1.88894 WP_000284051.1.88902 WP_000284051.1.8891 WP_000284051.1.88942 WP_000284051.1.88957 WP_000284051.1.88966 WP_000284051.1.88967 WP_000284051.1.88968 WP_000284051.1.88970 WP_000284051.1.88981 WP_000284051.1.88995 WP_000284051.1.88998 WP_000284051.1.89008 WP_000284051.1.89054 WP_000284051.1.89114 WP_000284051.1.89116 WP_000284051.1.89119 WP_000284051.1.89120 WP_000284051.1.89138 WP_000284051.1.89169 WP_000284051.1.89174 WP_000284051.1.89177 WP_000284051.1.89182 WP_000284051.1.89188 WP_000284051.1.89215 WP_000284051.1.89221 WP_000284051.1.89291 WP_000284051.1.89298 WP_000284051.1.89304 WP_000284051.1.89308 WP_000284051.1.89311 WP_000284051.1.89314 WP_000284051.1.89328 WP_000284051.1.89332 WP_000284051.1.89343 WP_000284051.1.89354 WP_000284051.1.89355 WP_000284051.1.89362 WP_000284051.1.89395 WP_000284051.1.8940 WP_000284051.1.89408 WP_000284051.1.89425 WP_000284051.1.89449 WP_000284051.1.89452 WP_000284051.1.89462 WP_000284051.1.8947 WP_000284051.1.89503 WP_000284051.1.89512 WP_000284051.1.89527 WP_000284051.1.89570 WP_000284051.1.8958 WP_000284051.1.89580 WP_000284051.1.89591 WP_000284051.1.89604 WP_000284051.1.89606 WP_000284051.1.8961 WP_000284051.1.89612 WP_000284051.1.89622 WP_000284051.1.89632 WP_000284051.1.89634 WP_000284051.1.89636 WP_000284051.1.89647 WP_000284051.1.89657 WP_000284051.1.89659 WP_000284051.1.89668 WP_000284051.1.89680 WP_000284051.1.89706 WP_000284051.1.89713 WP_000284051.1.89733 WP_000284051.1.89746 WP_000284051.1.89764 WP_000284051.1.89765 WP_000284051.1.89777 WP_000284051.1.89789 WP_000284051.1.89796 WP_000284051.1.89804 WP_000284051.1.89815 WP_000284051.1.89817 WP_000284051.1.89832 WP_000284051.1.89845 WP_000284051.1.89854 WP_000284051.1.89870 WP_000284051.1.89888 WP_000284051.1.89902 WP_000284051.1.89911 WP_000284051.1.89914 WP_000284051.1.89940 WP_000284051.1.8995 WP_000284051.1.89952 WP_000284051.1.8996 WP_000284051.1.89965 WP_000284051.1.89975 WP_000284051.1.90007 WP_000284051.1.9002 WP_000284051.1.9003 WP_000284051.1.90033 WP_000284051.1.90084 WP_000284051.1.90097 WP_000284051.1.90108 WP_000284051.1.9011 WP_000284051.1.90193 WP_000284051.1.90196 WP_000284051.1.90220 WP_000284051.1.90240 WP_000284051.1.90248 WP_000284051.1.90252 WP_000284051.1.90274 WP_000284051.1.90280 WP_000284051.1.90293 WP_000284051.1.90302 WP_000284051.1.90311 WP_000284051.1.90330 WP_000284051.1.90338 WP_000284051.1.90348 WP_000284051.1.90363 WP_000284051.1.90365 WP_000284051.1.90409 WP_000284051.1.90417 WP_000284051.1.90421 WP_000284051.1.90428 WP_000284051.1.90440 WP_000284051.1.90453 WP_000284051.1.90458 WP_000284051.1.90472 WP_000284051.1.90489 WP_000284051.1.90513 WP_000284051.1.90521 WP_000284051.1.90522 WP_000284051.1.90540 WP_000284051.1.90557 WP_000284051.1.90563 WP_000284051.1.90566 WP_000284051.1.90582 WP_000284051.1.90585 WP_000284051.1.90617 WP_000284051.1.90620 WP_000284051.1.90625 WP_000284051.1.9064 WP_000284051.1.90641 WP_000284051.1.90686 WP_000284051.1.90701 WP_000284051.1.90713 WP_000284051.1.90734 WP_000284051.1.90748 WP_000284051.1.90752 WP_000284051.1.90759 WP_000284051.1.90792 WP_000284051.1.90794 WP_000284051.1.90796 WP_000284051.1.90811 WP_000284051.1.90814 WP_000284051.1.90859 WP_000284051.1.90866 WP_000284051.1.90876 WP_000284051.1.90878 WP_000284051.1.9089 WP_000284051.1.9091 WP_000284051.1.9093 WP_000284051.1.90959 WP_000284051.1.90973 WP_000284051.1.90983 WP_000284051.1.90984 WP_000284051.1.90991 WP_000284051.1.91003 WP_000284051.1.91023 WP_000284051.1.91042 WP_000284051.1.91049 WP_000284051.1.91056 WP_000284051.1.91067 WP_000284051.1.91069 WP_000284051.1.91107 WP_000284051.1.91156 WP_000284051.1.91164 WP_000284051.1.91179 WP_000284051.1.91189 WP_000284051.1.91205 WP_000284051.1.91215 WP_000284051.1.91239 WP_000284051.1.91278 WP_000284051.1.91282 WP_000284051.1.91291 WP_000284051.1.9131 WP_000284051.1.91312 WP_000284051.1.91313 WP_000284051.1.91331 WP_000284051.1.91334 WP_000284051.1.9135 WP_000284051.1.9137 WP_000284051.1.91372 WP_000284051.1.91381 WP_000284051.1.91405 WP_000284051.1.91424 WP_000284051.1.91453 WP_000284051.1.91459 WP_000284051.1.91470 WP_000284051.1.91473 WP_000284051.1.91474 WP_000284051.1.91493 WP_000284051.1.91505 WP_000284051.1.91506 WP_000284051.1.91512 WP_000284051.1.91524 WP_000284051.1.91528 WP_000284051.1.91536 WP_000284051.1.91557 WP_000284051.1.91564 WP_000284051.1.91579 WP_000284051.1.91580 WP_000284051.1.91597 WP_000284051.1.91621 WP_000284051.1.91625 WP_000284051.1.91628 WP_000284051.1.91655 WP_000284051.1.9166 WP_000284051.1.91702 WP_000284051.1.91715 WP_000284051.1.91724 WP_000284051.1.91732 WP_000284051.1.91736 WP_000284051.1.91742 WP_000284051.1.91772 WP_000284051.1.91776 WP_000284051.1.91788 WP_000284051.1.91795 WP_000284051.1.91806 WP_000284051.1.91864 WP_000284051.1.9187 WP_000284051.1.91870 WP_000284051.1.91880 WP_000284051.1.91898 WP_000284051.1.91903 WP_000284051.1.91904 WP_000284051.1.91914 WP_000284051.1.91974 WP_000284051.1.91984 WP_000284051.1.92013 WP_000284051.1.92018 WP_000284051.1.92039 WP_000284051.1.92044 WP_000284051.1.92047 WP_000284051.1.92060 WP_000284051.1.92067 WP_000284051.1.92068 WP_000284051.1.92082 WP_000284051.1.92087 WP_000284051.1.92093 WP_000284051.1.92098 WP_000284051.1.92099 WP_000284051.1.92108 WP_000284051.1.92122 WP_000284051.1.92129 WP_000284051.1.92149 WP_000284051.1.92156 WP_000284051.1.92165 WP_000284051.1.92171 WP_000284051.1.92172 WP_000284051.1.92183 WP_000284051.1.92208 WP_000284051.1.92213 WP_000284051.1.9222 WP_000284051.1.92240 WP_000284051.1.92243 WP_000284051.1.92268 WP_000284051.1.92270 WP_000284051.1.92299 WP_000284051.1.92310 WP_000284051.1.92318 WP_000284051.1.92327 WP_000284051.1.92394 WP_000284051.1.92396 WP_000284051.1.92399 WP_000284051.1.92408 WP_000284051.1.92411 WP_000284051.1.92439 WP_000284051.1.92443 WP_000284051.1.92452 WP_000284051.1.92470 WP_000284051.1.92477 WP_000284051.1.92482 WP_000284051.1.92529 WP_000284051.1.9253 WP_000284051.1.92531 WP_000284051.1.92545 WP_000284051.1.92557 WP_000284051.1.92562 WP_000284051.1.92570 WP_000284051.1.92575 WP_000284051.1.92588 WP_000284051.1.926 WP_000284051.1.92628 WP_000284051.1.92633 WP_000284051.1.92646 WP_000284051.1.92649 WP_000284051.1.92659 WP_000284051.1.92669 WP_000284051.1.92671 WP_000284051.1.92676 WP_000284051.1.92705 WP_000284051.1.9271 WP_000284051.1.92729 WP_000284051.1.92734 WP_000284051.1.92738 WP_000284051.1.92758 WP_000284051.1.92786 WP_000284051.1.92806 WP_000284051.1.92810 WP_000284051.1.92823 WP_000284051.1.92827 WP_000284051.1.92832 WP_000284051.1.92836 WP_000284051.1.92842 WP_000284051.1.92843 WP_000284051.1.92875 WP_000284051.1.92879 WP_000284051.1.92883 WP_000284051.1.92890 WP_000284051.1.92893 WP_000284051.1.92895 WP_000284051.1.92926 WP_000284051.1.92929 WP_000284051.1.92936 WP_000284051.1.92939 WP_000284051.1.92947 WP_000284051.1.92975 WP_000284051.1.92987 WP_000284051.1.92988 WP_000284051.1.93007 WP_000284051.1.93022 WP_000284051.1.93059 WP_000284051.1.93061 WP_000284051.1.93076 WP_000284051.1.93086 WP_000284051.1.93101 WP_000284051.1.93103 WP_000284051.1.93105 WP_000284051.1.93111 WP_000284051.1.93118 WP_000284051.1.93121 WP_000284051.1.93136 WP_000284051.1.93155 WP_000284051.1.93168 WP_000284051.1.93184 WP_000284051.1.93213 WP_000284051.1.93215 WP_000284051.1.93221 WP_000284051.1.93223 WP_000284051.1.93239 WP_000284051.1.93275 WP_000284051.1.93302 WP_000284051.1.93322 WP_000284051.1.93339 WP_000284051.1.93350 WP_000284051.1.9336 WP_000284051.1.93365 WP_000284051.1.93376 WP_000284051.1.93387 WP_000284051.1.93469 WP_000284051.1.93511 WP_000284051.1.93512 WP_000284051.1.93524 WP_000284051.1.93543 WP_000284051.1.93577 WP_000284051.1.93596 WP_000284051.1.93604 WP_000284051.1.93635 WP_000284051.1.93648 WP_000284051.1.93650 WP_000284051.1.93656 WP_000284051.1.93657 WP_000284051.1.93662 WP_000284051.1.93671 WP_000284051.1.93691 WP_000284051.1.937 WP_000284051.1.93705 WP_000284051.1.9374 WP_000284051.1.93741 WP_000284051.1.9375 WP_000284051.1.93754 WP_000284051.1.93761 WP_000284051.1.93767 WP_000284051.1.93780 WP_000284051.1.9380 WP_000284051.1.93803 WP_000284051.1.93804 WP_000284051.1.93809 WP_000284051.1.93828 WP_000284051.1.93837 WP_000284051.1.93842 WP_000284051.1.93843 WP_000284051.1.93875 WP_000284051.1.9389 WP_000284051.1.93909 WP_000284051.1.93919 WP_000284051.1.93937 WP_000284051.1.93938 WP_000284051.1.9394 WP_000284051.1.93956 WP_000284051.1.93984 WP_000284051.1.93986 WP_000284051.1.9399 WP_000284051.1.93994 WP_000284051.1.94017 WP_000284051.1.94039 WP_000284051.1.94056 WP_000284051.1.94064 WP_000284051.1.94070 WP_000284051.1.94071 WP_000284051.1.94072 WP_000284051.1.94079 WP_000284051.1.94097 WP_000284051.1.94107 WP_000284051.1.94132 WP_000284051.1.94142 WP_000284051.1.94162 WP_000284051.1.94167 WP_000284051.1.94168 WP_000284051.1.94181 WP_000284051.1.94198 WP_000284051.1.94215 WP_000284051.1.94303 WP_000284051.1.9432 WP_000284051.1.94352 WP_000284051.1.94354 WP_000284051.1.94365 WP_000284051.1.94379 WP_000284051.1.94380 WP_000284051.1.94383 WP_000284051.1.94390 WP_000284051.1.9440 WP_000284051.1.94412 WP_000284051.1.94415 WP_000284051.1.94458 WP_000284051.1.94461 WP_000284051.1.94473 WP_000284051.1.94492 WP_000284051.1.94510 WP_000284051.1.94527 WP_000284051.1.94557 WP_000284051.1.94562 WP_000284051.1.94565 WP_000284051.1.94573 WP_000284051.1.94579 WP_000284051.1.94584 WP_000284051.1.94586 WP_000284051.1.94588 WP_000284051.1.94593 WP_000284051.1.94598 WP_000284051.1.94622 WP_000284051.1.9463 WP_000284051.1.94649 WP_000284051.1.94650 WP_000284051.1.94655 WP_000284051.1.94659 WP_000284051.1.94662 WP_000284051.1.94669 WP_000284051.1.94670 WP_000284051.1.94674 WP_000284051.1.94700 WP_000284051.1.94717 WP_000284051.1.94722 WP_000284051.1.94745 WP_000284051.1.94782 WP_000284051.1.94785 WP_000284051.1.94796 WP_000284051.1.94798 WP_000284051.1.9481 WP_000284051.1.94815 WP_000284051.1.94817 WP_000284051.1.94820 WP_000284051.1.94835 WP_000284051.1.94849 WP_000284051.1.94850 WP_000284051.1.94851 WP_000284051.1.94862 WP_000284051.1.94864 WP_000284051.1.94921 WP_000284051.1.94947 WP_000284051.1.94952 WP_000284051.1.94959 WP_000284051.1.94967 WP_000284051.1.94971 WP_000284051.1.94982 WP_000284051.1.94986 WP_000284051.1.94987 WP_000284051.1.95006 WP_000284051.1.9503 WP_000284051.1.95051 WP_000284051.1.95055 WP_000284051.1.95076 WP_000284051.1.95085 WP_000284051.1.95094 WP_000284051.1.95099 WP_000284051.1.95121 WP_000284051.1.95133 WP_000284051.1.95136 WP_000284051.1.95152 WP_000284051.1.9516 WP_000284051.1.95165 WP_000284051.1.95171 WP_000284051.1.95235 WP_000284051.1.95239 WP_000284051.1.95246 WP_000284051.1.95248 WP_000284051.1.95249 WP_000284051.1.9525 WP_000284051.1.95255 WP_000284051.1.95265 WP_000284051.1.9527 WP_000284051.1.95277 WP_000284051.1.95282 WP_000284051.1.95289 WP_000284051.1.95298 WP_000284051.1.9530 WP_000284051.1.95320 WP_000284051.1.95338 WP_000284051.1.95388 WP_000284051.1.95404 WP_000284051.1.95412 WP_000284051.1.95434 WP_000284051.1.95447 WP_000284051.1.95456 WP_000284051.1.95465 WP_000284051.1.95530 WP_000284051.1.95546 WP_000284051.1.95547 WP_000284051.1.95579 WP_000284051.1.95590 WP_000284051.1.95607 WP_000284051.1.95623 WP_000284051.1.95625 WP_000284051.1.95630 WP_000284051.1.95641 WP_000284051.1.95656 WP_000284051.1.95670 WP_000284051.1.95675 WP_000284051.1.95691 WP_000284051.1.95701 WP_000284051.1.95703 WP_000284051.1.95716 WP_000284051.1.95729 WP_000284051.1.9574 WP_000284051.1.95744 WP_000284051.1.95757 WP_000284051.1.95776 WP_000284051.1.95803 WP_000284051.1.95805 WP_000284051.1.95826 WP_000284051.1.95840 WP_000284051.1.9586 WP_000284051.1.95866 WP_000284051.1.95884 WP_000284051.1.95890 WP_000284051.1.95901 WP_000284051.1.95906 WP_000284051.1.95911 WP_000284051.1.95939 WP_000284051.1.95940 WP_000284051.1.95963 WP_000284051.1.96004 WP_000284051.1.96025 WP_000284051.1.96042 WP_000284051.1.96044 WP_000284051.1.96045 WP_000284051.1.96054 WP_000284051.1.9609 WP_000284051.1.96094 WP_000284051.1.96107 WP_000284051.1.96127 WP_000284051.1.96139 WP_000284051.1.96141 WP_000284051.1.96144 WP_000284051.1.96162 WP_000284051.1.96172 WP_000284051.1.96188 WP_000284051.1.96190 WP_000284051.1.96203 WP_000284051.1.96206 WP_000284051.1.96211 WP_000284051.1.96212 WP_000284051.1.9624 WP_000284051.1.96260 WP_000284051.1.9627 WP_000284051.1.96317 WP_000284051.1.96319 WP_000284051.1.9633 WP_000284051.1.96335 WP_000284051.1.96340 WP_000284051.1.96343 WP_000284051.1.96348 WP_000284051.1.96349 WP_000284051.1.96359 WP_000284051.1.96380 WP_000284051.1.96404 WP_000284051.1.96429 WP_000284051.1.9644 WP_000284051.1.96469 WP_000284051.1.96497 WP_000284051.1.96500 WP_000284051.1.96521 WP_000284051.1.96533 WP_000284051.1.96537 WP_000284051.1.96539 WP_000284051.1.96552 WP_000284051.1.96555 WP_000284051.1.96563 WP_000284051.1.96588 WP_000284051.1.96600 WP_000284051.1.96610 WP_000284051.1.96625 WP_000284051.1.96635 WP_000284051.1.9664 WP_000284051.1.96640 WP_000284051.1.96642 WP_000284051.1.96662 WP_000284051.1.96675 WP_000284051.1.9670 WP_000284051.1.96721 WP_000284051.1.96731 WP_000284051.1.96732 WP_000284051.1.96735 WP_000284051.1.9674 WP_000284051.1.96750 WP_000284051.1.96758 WP_000284051.1.96761 WP_000284051.1.96771 WP_000284051.1.96792 WP_000284051.1.96798 WP_000284051.1.96801 WP_000284051.1.96803 WP_000284051.1.96810 WP_000284051.1.9686 WP_000284051.1.96876 WP_000284051.1.96890 WP_000284051.1.96902 WP_000284051.1.96917 WP_000284051.1.96925 WP_000284051.1.96938 WP_000284051.1.96946 WP_000284051.1.96957 WP_000284051.1.96978 WP_000284051.1.96993 WP_000284051.1.97005 WP_000284051.1.97015 WP_000284051.1.97026 WP_000284051.1.97028 WP_000284051.1.97043 WP_000284051.1.97047 WP_000284051.1.97079 WP_000284051.1.97089 WP_000284051.1.97103 WP_000284051.1.97109 WP_000284051.1.97143 WP_000284051.1.97145 WP_000284051.1.97154 WP_000284051.1.97184 WP_000284051.1.97185 WP_000284051.1.97190 WP_000284051.1.97224 WP_000284051.1.97287 WP_000284051.1.97291 WP_000284051.1.97297 WP_000284051.1.97318 WP_000284051.1.97322 WP_000284051.1.97328 WP_000284051.1.97337 WP_000284051.1.97368 WP_000284051.1.97369 WP_000284051.1.97386 WP_000284051.1.97413 WP_000284051.1.97422 WP_000284051.1.97441 WP_000284051.1.97477 WP_000284051.1.97480 WP_000284051.1.97487 WP_000284051.1.97496 WP_000284051.1.97497 WP_000284051.1.97505 WP_000284051.1.97534 WP_000284051.1.97547 WP_000284051.1.97597 WP_000284051.1.97599 WP_000284051.1.97604 WP_000284051.1.97606 WP_000284051.1.97613 WP_000284051.1.97615 WP_000284051.1.97620 WP_000284051.1.97626 WP_000284051.1.97628 WP_000284051.1.97631 WP_000284051.1.97640 WP_000284051.1.97646 WP_000284051.1.97648 WP_000284051.1.97656 WP_000284051.1.97690 WP_000284051.1.97691 WP_000284051.1.97693 WP_000284051.1.97704 WP_000284051.1.97725 WP_000284051.1.97726 WP_000284051.1.97727 WP_000284051.1.97732 WP_000284051.1.97736 WP_000284051.1.9774 WP_000284051.1.9775 WP_000284051.1.97768 WP_000284051.1.97772 WP_000284051.1.97800 WP_000284051.1.97819 WP_000284051.1.97840 WP_000284051.1.97846 WP_000284051.1.97873 WP_000284051.1.97907 WP_000284051.1.9793 WP_000284051.1.97938 WP_000284051.1.97981 WP_000284051.1.97983 WP_000284051.1.97986 WP_000284051.1.9799 WP_000284051.1.97991 WP_000284051.1.98006 WP_000284051.1.98019 WP_000284051.1.98022 WP_000284051.1.98036 WP_000284051.1.9805 WP_000284051.1.98080 WP_000284051.1.98086 WP_000284051.1.98107 WP_000284051.1.9811 WP_000284051.1.98110 WP_000284051.1.98119 WP_000284051.1.98124 WP_000284051.1.98146 WP_000284051.1.98158 WP_000284051.1.98170 WP_000284051.1.98201 WP_000284051.1.98219 WP_000284051.1.98236 WP_000284051.1.98250 WP_000284051.1.9826 WP_000284051.1.98263 WP_000284051.1.98314 WP_000284051.1.98338 WP_000284051.1.98392 WP_000284051.1.98402 WP_000284051.1.98403 WP_000284051.1.9841 WP_000284051.1.98418 WP_000284051.1.98438 WP_000284051.1.98440 WP_000284051.1.98446 WP_000284051.1.98448 WP_000284051.1.98457 WP_000284051.1.98472 WP_000284051.1.98483 WP_000284051.1.98495 WP_000284051.1.9850 WP_000284051.1.98502 WP_000284051.1.98513 WP_000284051.1.98531 WP_000284051.1.98551 WP_000284051.1.98570 WP_000284051.1.98577 WP_000284051.1.98607 WP_000284051.1.98608 WP_000284051.1.98627 WP_000284051.1.9863 WP_000284051.1.98634 WP_000284051.1.98676 WP_000284051.1.98677 WP_000284051.1.98726 WP_000284051.1.98731 WP_000284051.1.98751 WP_000284051.1.98760 WP_000284051.1.98762 WP_000284051.1.98763 WP_000284051.1.9877 WP_000284051.1.98779 WP_000284051.1.98801 WP_000284051.1.98818 WP_000284051.1.98843 WP_000284051.1.9887 WP_000284051.1.98899 WP_000284051.1.98931 WP_000284051.1.98947 WP_000284051.1.9898 WP_000284051.1.9899 WP_000284051.1.99040 WP_000284051.1.99057 WP_000284051.1.99071 WP_000284051.1.99072 WP_000284051.1.99073 WP_000284051.1.99083 WP_000284051.1.99097 WP_000284051.1.99098 WP_000284051.1.99107 WP_000284051.1.99163 WP_000284051.1.99164 WP_000284051.1.99184 WP_000284051.1.9919 WP_000284051.1.99197 WP_000284051.1.99198 WP_000284051.1.99215 WP_000284051.1.99219 WP_000284051.1.99255 WP_000284051.1.99267 WP_000284051.1.99276 WP_000284051.1.99278 WP_000284051.1.99320 WP_000284051.1.99327 WP_000284051.1.99335 WP_000284051.1.99339 WP_000284051.1.99350 WP_000284051.1.99360 WP_000284051.1.99363 WP_000284051.1.99369 WP_000284051.1.99370 WP_000284051.1.99388 WP_000284051.1.99397 WP_000284051.1.99426 WP_000284051.1.99456 WP_000284051.1.99463 WP_000284051.1.99469 WP_000284051.1.99483 WP_000284051.1.99490 WP_000284051.1.99493 WP_000284051.1.99531 WP_000284051.1.9954 WP_000284051.1.99546 WP_000284051.1.99561 WP_000284051.1.99579 WP_000284051.1.99595 WP_000284051.1.99613 WP_000284051.1.99626 WP_000284051.1.99630 WP_000284051.1.99637 WP_000284051.1.99646 WP_000284051.1.99657 WP_000284051.1.99660 WP_000284051.1.99671 WP_000284051.1.99676 WP_000284051.1.99712 WP_000284051.1.99725 WP_000284051.1.99747 WP_000284051.1.99764 WP_000284051.1.99783 WP_000284051.1.99813 WP_000284051.1.99824 WP_000284051.1.99829 WP_000284051.1.99837 WP_000284051.1.99841 WP_000284051.1.99858 WP_000284051.1.99889 WP_000284051.1.9992 WP_000284051.1.99924 WP_000284051.1.99958 WP_000284051.1.99961 WP_000284051.1.99996 gi|529220610|ref|YP_008381909.1| gi|378956301|ref|YP_005213788.1| gi|538360862|ref|YP_008504147.1| gi|525839257|ref|YP_008256516.1| gi|525816180|ref|YP_008246198.1| gi|526219232|ref|YP_008264565.1| gi|386590189|ref|YP_006086589.1| gi|62178881|ref|YP_215298.1| gi|378698278|ref|YP_005180235.1| gi|378982851|ref|YP_005246006.1| gi|452121426|ref|YP_007471674.1| ABAK02000001|CDS_4520460-4521038 ABAM02000001|CDS_855215-855793 ABAN01000027|CDS_13808-13230 ABAO01000023|CDS_42876-43454 ABEH02000001|CDS_710820-711398 ABEI01000010|CDS_75368-75946 ABEJ01000020|CDS_15712-15134 ABEL01000001|CDS_60884-61462 ABEW01000005|CDS_67250-67828 ABFF01000003|CDS_331915-331337 ABFG01000003|CDS_377402-376824 ABFH02000002|CDS_1779441-1778863 AE006468|CDS_355281-355859 AE014613|CDS_2616486-2615908 AE017220|CDS_359239-359817 AL513382|CDS_364627-365205 AM933172|CDS_334760-335338 AM933173|CDS_353444-354022 CP000026|CDS_2541144-2540566 CP000886|CDS_2762064-2761486 CP001113|CDS_359734-360312 CP001120|CDS_363239-363817 CP001127|CDS_365479-366057 CP001138|CDS_337877-338455 CP001363|CDS_355966-356544 FM200053|CDS_2536680-2536102 FN424405|CDS_355252-355830 NZ_ACBF01000023|CDS_37906-37328 gi|537437869|ref|YP_008482246.1| APC24295 IDP00124 gi|525948278|ref|YP_008309840.1| gi|378448626|ref|YP_005235985.1| gi|525856698|ref|YP_008259565.1| gi|207855795|ref|YP_002242446.1| gi|197248959|ref|YP_002145292.1| gi|205351634|ref|YP_002225435.1| gi|549723028|ref|YP_008643218.1| gi|378987712|ref|YP_005250876.1| gi|197363492|ref|YP_002143129.1| gi|526226222|ref|YP_008320865.1| 209261.t2540 220341.STY0355 272994.SPAB_03292 295319.SPA2445 321314.SC0311 423368.SNSL254_A0349 439843.SeSA_A0359 454166.SeAg_B0344 454169.SeHA_C0351 550537.SEN0293 550538.SG0321 554290.SSPA2283 99287.STM0310 gi|482905167|ref|YP_007903727.1| gi|194451924|ref|YP_002044294.1| gi|525827680|ref|YP_008250354.1| gi|409248737|ref|YP_006884577.1| gi|29142922|ref|NP_806264.1| gi|339998279|ref|YP_004729162.1| gi|549478392|ref|YP_008612162.1| gi|194445657|ref|YP_002039552.1| gi|56414562|ref|YP_151637.1| gi|378960720|ref|YP_005218206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]