SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197249348|ref|YP_002148193.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197249348|ref|YP_002148193.1|
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily SIS domain 5.06e-51
Family mono-SIS domain 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197249348|ref|YP_002148193.1|
Sequence length 196
Comment DnaA initiator-associating protein DiaA [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MLERIKVCFTESIQTQIAAAEALPDAISRAAMTLVHSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEVYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHHSARIQEMHMLTVN
CLCDLIDNTLFPHQDD
Download sequence
Identical sequences A0A089GF57 A0A0D6IBV2 A0A0F5BFS1 A0A0F6B750 A0A0F7JDG7 A0A0H3NGA8 A0A0K0HEY5 A0A0L5XRF8 A0A0M0QHN6 A0A0R9Q711 A0A0T9VCF0 A0A0T9YBI8 A0A0V2CS24 A0A0V2EBJ3 A0A1C2ZXA4 A0A1J7A251 A0A1M3YCG6 A0A1S0ZD93 A0A1S1AK24 A0A1X2TK18 A0A1X2ULV4 A0A1X2Y0G5 A0A1Z3QAB5 A0A221YQE5 A0A221Z8G1 A0A241S8U9 A0A248K4R3 A0A265B3E1 A0A267SDV1 A0A271CG16 A0A271CYT1 A0A2C6G452 A0A2C9NV96 A0A2D1XM75 A0A2D1Y0Z4 A0A2D3AGP7 A0A2D3TRL7 A0A2G1P468 A0A2H9YJB4 A0A2I6M3L4 A0A2I6MH47 A0A2I6MUX7 A0A2I6N905 A0A2I6NLP1 A0A2I6NZN5 A0A2K2S1V9 A0A2K2S7Q6 A0A2K2STK5 A0A2K2SW21 A0A2K2TCY0 A9N712 B4T6Y1 B4TIY9 B4TWC0 B5F6R9 B5FHZ4 B5QZT8 B5REL6 C0PZ34 Q57JJ9 Q8ZLU2 S5HQ04 S5NJW1 V1HAE5 V1WEH3 V7V1X3
272994.SPAB_04077 321314.SC3207 423368.SNSL254_A3524 439843.SeSA_A3455 439851.SeD_A3621 454166.SeAg_B3453 454169.SeHA_C3561 476213.SPC_3337 550537.SEN3101 550538.SG3157 99287.STM3266 gi|378990577|ref|YP_005253741.1| gi|194448064|ref|YP_002047298.1| gi|16766564|ref|NP_462179.1| gi|525814545|ref|YP_008244563.1| gi|525946027|ref|YP_008307067.1| gi|525858999|ref|YP_008262522.1| gi|526221610|ref|YP_008267463.1| gi|386592954|ref|YP_006089354.1| gi|340000826|ref|YP_004731710.1| gi|452122912|ref|YP_007473160.1| gi|197249348|ref|YP_002148193.1| gi|549725827|ref|YP_008646017.1| gi|224585064|ref|YP_002638863.1| gi|550902623|ref|YP_008671715.1| gi|528821103|ref|YP_008362306.1| gi|194446078|ref|YP_002042526.1| gi|205354170|ref|YP_002227971.1| gi|537438446|ref|YP_008482823.1| gi|525828946|ref|YP_008251935.1| gi|62181777|ref|YP_218194.1| NP_462179.1.58477 WP_000893481.1.100007 WP_000893481.1.10013 WP_000893481.1.100149 WP_000893481.1.100191 WP_000893481.1.1002 WP_000893481.1.100234 WP_000893481.1.100258 WP_000893481.1.100266 WP_000893481.1.100288 WP_000893481.1.100376 WP_000893481.1.100412 WP_000893481.1.100424 WP_000893481.1.100436 WP_000893481.1.100438 WP_000893481.1.100457 WP_000893481.1.100488 WP_000893481.1.100519 WP_000893481.1.100521 WP_000893481.1.100557 WP_000893481.1.100584 WP_000893481.1.100597 WP_000893481.1.100605 WP_000893481.1.100642 WP_000893481.1.10065 WP_000893481.1.100711 WP_000893481.1.100721 WP_000893481.1.100730 WP_000893481.1.10076 WP_000893481.1.100773 WP_000893481.1.100776 WP_000893481.1.100781 WP_000893481.1.100793 WP_000893481.1.10081 WP_000893481.1.100814 WP_000893481.1.100857 WP_000893481.1.100869 WP_000893481.1.100871 WP_000893481.1.100882 WP_000893481.1.100886 WP_000893481.1.100895 WP_000893481.1.100932 WP_000893481.1.100944 WP_000893481.1.101007 WP_000893481.1.101020 WP_000893481.1.101078 WP_000893481.1.101091 WP_000893481.1.101112 WP_000893481.1.101123 WP_000893481.1.101147 WP_000893481.1.101180 WP_000893481.1.101185 WP_000893481.1.101291 WP_000893481.1.101320 WP_000893481.1.101404 WP_000893481.1.101454 WP_000893481.1.101473 WP_000893481.1.101541 WP_000893481.1.101609 WP_000893481.1.101634 WP_000893481.1.101636 WP_000893481.1.101639 WP_000893481.1.101674 WP_000893481.1.101707 WP_000893481.1.101724 WP_000893481.1.101740 WP_000893481.1.101741 WP_000893481.1.101744 WP_000893481.1.101759 WP_000893481.1.10177 WP_000893481.1.101815 WP_000893481.1.101832 WP_000893481.1.101839 WP_000893481.1.101868 WP_000893481.1.10191 WP_000893481.1.101917 WP_000893481.1.101949 WP_000893481.1.102009 WP_000893481.1.102111 WP_000893481.1.10237 WP_000893481.1.10266 WP_000893481.1.10276 WP_000893481.1.10293 WP_000893481.1.10300 WP_000893481.1.10429 WP_000893481.1.10439 WP_000893481.1.10463 WP_000893481.1.10498 WP_000893481.1.10521 WP_000893481.1.10562 WP_000893481.1.10566 WP_000893481.1.10631 WP_000893481.1.10678 WP_000893481.1.10711 WP_000893481.1.10720 WP_000893481.1.10753 WP_000893481.1.10797 WP_000893481.1.10868 WP_000893481.1.10898 WP_000893481.1.11098 WP_000893481.1.11119 WP_000893481.1.11156 WP_000893481.1.11168 WP_000893481.1.11216 WP_000893481.1.1135 WP_000893481.1.1137 WP_000893481.1.11386 WP_000893481.1.11405 WP_000893481.1.11458 WP_000893481.1.11479 WP_000893481.1.1150 WP_000893481.1.11511 WP_000893481.1.11518 WP_000893481.1.11526 WP_000893481.1.11528 WP_000893481.1.11544 WP_000893481.1.1156 WP_000893481.1.11588 WP_000893481.1.11603 WP_000893481.1.11621 WP_000893481.1.11677 WP_000893481.1.11681 WP_000893481.1.11687 WP_000893481.1.1169 WP_000893481.1.11735 WP_000893481.1.1174 WP_000893481.1.11763 WP_000893481.1.11772 WP_000893481.1.11834 WP_000893481.1.11841 WP_000893481.1.11868 WP_000893481.1.11875 WP_000893481.1.11897 WP_000893481.1.11900 WP_000893481.1.11964 WP_000893481.1.11978 WP_000893481.1.12007 WP_000893481.1.12017 WP_000893481.1.12025 WP_000893481.1.12027 WP_000893481.1.12106 WP_000893481.1.12114 WP_000893481.1.1215 WP_000893481.1.12168 WP_000893481.1.12244 WP_000893481.1.1232 WP_000893481.1.12340 WP_000893481.1.12351 WP_000893481.1.12374 WP_000893481.1.12396 WP_000893481.1.12456 WP_000893481.1.1246 WP_000893481.1.12484 WP_000893481.1.12485 WP_000893481.1.1250 WP_000893481.1.12546 WP_000893481.1.12568 WP_000893481.1.12569 WP_000893481.1.12585 WP_000893481.1.12696 WP_000893481.1.12864 WP_000893481.1.12879 WP_000893481.1.12936 WP_000893481.1.1299 WP_000893481.1.1300 WP_000893481.1.13027 WP_000893481.1.13076 WP_000893481.1.13101 WP_000893481.1.13102 WP_000893481.1.13106 WP_000893481.1.13130 WP_000893481.1.13207 WP_000893481.1.13274 WP_000893481.1.13311 WP_000893481.1.13334 WP_000893481.1.13367 WP_000893481.1.13391 WP_000893481.1.13414 WP_000893481.1.13429 WP_000893481.1.13446 WP_000893481.1.13543 WP_000893481.1.13573 WP_000893481.1.13625 WP_000893481.1.13691 WP_000893481.1.13741 WP_000893481.1.13819 WP_000893481.1.13848 WP_000893481.1.13857 WP_000893481.1.1387 WP_000893481.1.14001 WP_000893481.1.14011 WP_000893481.1.14041 WP_000893481.1.14050 WP_000893481.1.14056 WP_000893481.1.14111 WP_000893481.1.1412 WP_000893481.1.14151 WP_000893481.1.14212 WP_000893481.1.14239 WP_000893481.1.14286 WP_000893481.1.14379 WP_000893481.1.1440 WP_000893481.1.14406 WP_000893481.1.14410 WP_000893481.1.14446 WP_000893481.1.14458 WP_000893481.1.14466 WP_000893481.1.14495 WP_000893481.1.14505 WP_000893481.1.14516 WP_000893481.1.14519 WP_000893481.1.14524 WP_000893481.1.14528 WP_000893481.1.14554 WP_000893481.1.146 WP_000893481.1.14706 WP_000893481.1.14708 WP_000893481.1.14789 WP_000893481.1.14793 WP_000893481.1.14819 WP_000893481.1.14852 WP_000893481.1.14876 WP_000893481.1.1489 WP_000893481.1.14913 WP_000893481.1.14927 WP_000893481.1.14932 WP_000893481.1.14964 WP_000893481.1.15046 WP_000893481.1.15054 WP_000893481.1.15055 WP_000893481.1.15067 WP_000893481.1.15079 WP_000893481.1.15100 WP_000893481.1.15102 WP_000893481.1.15124 WP_000893481.1.15223 WP_000893481.1.15226 WP_000893481.1.15276 WP_000893481.1.15318 WP_000893481.1.15353 WP_000893481.1.1540 WP_000893481.1.15479 WP_000893481.1.1551 WP_000893481.1.15585 WP_000893481.1.15625 WP_000893481.1.15627 WP_000893481.1.15637 WP_000893481.1.15644 WP_000893481.1.15667 WP_000893481.1.1568 WP_000893481.1.15708 WP_000893481.1.15775 WP_000893481.1.15777 WP_000893481.1.15784 WP_000893481.1.15795 WP_000893481.1.15862 WP_000893481.1.15909 WP_000893481.1.15910 WP_000893481.1.15922 WP_000893481.1.15978 WP_000893481.1.15986 WP_000893481.1.16004 WP_000893481.1.1601 WP_000893481.1.16028 WP_000893481.1.16052 WP_000893481.1.16062 WP_000893481.1.16063 WP_000893481.1.16103 WP_000893481.1.16158 WP_000893481.1.16166 WP_000893481.1.16201 WP_000893481.1.16284 WP_000893481.1.16361 WP_000893481.1.16363 WP_000893481.1.16365 WP_000893481.1.16366 WP_000893481.1.16394 WP_000893481.1.16468 WP_000893481.1.16474 WP_000893481.1.16508 WP_000893481.1.16525 WP_000893481.1.16551 WP_000893481.1.16565 WP_000893481.1.16614 WP_000893481.1.1668 WP_000893481.1.16686 WP_000893481.1.16691 WP_000893481.1.167 WP_000893481.1.16729 WP_000893481.1.16732 WP_000893481.1.16735 WP_000893481.1.16736 WP_000893481.1.16786 WP_000893481.1.16804 WP_000893481.1.16846 WP_000893481.1.16855 WP_000893481.1.1689 WP_000893481.1.16896 WP_000893481.1.16903 WP_000893481.1.16941 WP_000893481.1.16942 WP_000893481.1.16944 WP_000893481.1.16949 WP_000893481.1.16972 WP_000893481.1.1700 WP_000893481.1.17060 WP_000893481.1.17098 WP_000893481.1.17105 WP_000893481.1.17270 WP_000893481.1.1733 WP_000893481.1.1737 WP_000893481.1.174 WP_000893481.1.17482 WP_000893481.1.17525 WP_000893481.1.17560 WP_000893481.1.1757 WP_000893481.1.17583 WP_000893481.1.17629 WP_000893481.1.17693 WP_000893481.1.17694 WP_000893481.1.17705 WP_000893481.1.17732 WP_000893481.1.17743 WP_000893481.1.17758 WP_000893481.1.17886 WP_000893481.1.17891 WP_000893481.1.17901 WP_000893481.1.17914 WP_000893481.1.17936 WP_000893481.1.17949 WP_000893481.1.18019 WP_000893481.1.18022 WP_000893481.1.18056 WP_000893481.1.18061 WP_000893481.1.18092 WP_000893481.1.18103 WP_000893481.1.18109 WP_000893481.1.18111 WP_000893481.1.18122 WP_000893481.1.1814 WP_000893481.1.18149 WP_000893481.1.18178 WP_000893481.1.1818 WP_000893481.1.18192 WP_000893481.1.18249 WP_000893481.1.18254 WP_000893481.1.18267 WP_000893481.1.18281 WP_000893481.1.18384 WP_000893481.1.18426 WP_000893481.1.18441 WP_000893481.1.18468 WP_000893481.1.18641 WP_000893481.1.18686 WP_000893481.1.18688 WP_000893481.1.18692 WP_000893481.1.18705 WP_000893481.1.18715 WP_000893481.1.18737 WP_000893481.1.18796 WP_000893481.1.18822 WP_000893481.1.18847 WP_000893481.1.18886 WP_000893481.1.18895 WP_000893481.1.18919 WP_000893481.1.18949 WP_000893481.1.1895 WP_000893481.1.1897 WP_000893481.1.18972 WP_000893481.1.19030 WP_000893481.1.19053 WP_000893481.1.19093 WP_000893481.1.19273 WP_000893481.1.19340 WP_000893481.1.1935 WP_000893481.1.19357 WP_000893481.1.19373 WP_000893481.1.19433 WP_000893481.1.19458 WP_000893481.1.19460 WP_000893481.1.19461 WP_000893481.1.1954 WP_000893481.1.1955 WP_000893481.1.19588 WP_000893481.1.19616 WP_000893481.1.19642 WP_000893481.1.19656 WP_000893481.1.19683 WP_000893481.1.19706 WP_000893481.1.19724 WP_000893481.1.19749 WP_000893481.1.19802 WP_000893481.1.19809 WP_000893481.1.19823 WP_000893481.1.19834 WP_000893481.1.19851 WP_000893481.1.19884 WP_000893481.1.19967 WP_000893481.1.19970 WP_000893481.1.19975 WP_000893481.1.1998 WP_000893481.1.20 WP_000893481.1.20023 WP_000893481.1.20081 WP_000893481.1.20086 WP_000893481.1.20089 WP_000893481.1.20153 WP_000893481.1.2026 WP_000893481.1.20261 WP_000893481.1.20266 WP_000893481.1.20271 WP_000893481.1.20330 WP_000893481.1.20349 WP_000893481.1.20364 WP_000893481.1.2041 WP_000893481.1.20418 WP_000893481.1.20437 WP_000893481.1.20443 WP_000893481.1.2047 WP_000893481.1.20503 WP_000893481.1.20525 WP_000893481.1.20553 WP_000893481.1.20573 WP_000893481.1.20626 WP_000893481.1.20631 WP_000893481.1.20646 WP_000893481.1.20695 WP_000893481.1.20760 WP_000893481.1.20787 WP_000893481.1.20789 WP_000893481.1.20795 WP_000893481.1.20839 WP_000893481.1.20862 WP_000893481.1.20886 WP_000893481.1.20894 WP_000893481.1.20908 WP_000893481.1.2091 WP_000893481.1.2101 WP_000893481.1.21079 WP_000893481.1.21086 WP_000893481.1.21103 WP_000893481.1.2116 WP_000893481.1.21165 WP_000893481.1.21194 WP_000893481.1.21202 WP_000893481.1.21241 WP_000893481.1.21246 WP_000893481.1.21269 WP_000893481.1.21309 WP_000893481.1.21326 WP_000893481.1.21332 WP_000893481.1.21362 WP_000893481.1.21443 WP_000893481.1.21453 WP_000893481.1.2146 WP_000893481.1.21473 WP_000893481.1.21499 WP_000893481.1.21548 WP_000893481.1.2155 WP_000893481.1.21692 WP_000893481.1.21715 WP_000893481.1.21728 WP_000893481.1.21730 WP_000893481.1.21750 WP_000893481.1.21751 WP_000893481.1.21792 WP_000893481.1.21845 WP_000893481.1.21877 WP_000893481.1.21886 WP_000893481.1.21910 WP_000893481.1.21940 WP_000893481.1.21981 WP_000893481.1.22019 WP_000893481.1.22030 WP_000893481.1.2205 WP_000893481.1.22051 WP_000893481.1.22096 WP_000893481.1.22117 WP_000893481.1.22136 WP_000893481.1.22158 WP_000893481.1.22162 WP_000893481.1.22205 WP_000893481.1.2221 WP_000893481.1.2224 WP_000893481.1.22296 WP_000893481.1.22315 WP_000893481.1.22323 WP_000893481.1.22346 WP_000893481.1.22379 WP_000893481.1.22388 WP_000893481.1.22427 WP_000893481.1.22449 WP_000893481.1.22453 WP_000893481.1.22454 WP_000893481.1.22460 WP_000893481.1.22514 WP_000893481.1.22537 WP_000893481.1.22565 WP_000893481.1.22595 WP_000893481.1.22604 WP_000893481.1.22605 WP_000893481.1.22620 WP_000893481.1.22623 WP_000893481.1.22676 WP_000893481.1.22758 WP_000893481.1.22760 WP_000893481.1.2283 WP_000893481.1.22845 WP_000893481.1.22855 WP_000893481.1.22857 WP_000893481.1.22880 WP_000893481.1.22902 WP_000893481.1.22947 WP_000893481.1.22966 WP_000893481.1.23053 WP_000893481.1.23080 WP_000893481.1.23114 WP_000893481.1.23155 WP_000893481.1.23172 WP_000893481.1.23201 WP_000893481.1.23219 WP_000893481.1.2324 WP_000893481.1.23246 WP_000893481.1.23259 WP_000893481.1.23274 WP_000893481.1.23311 WP_000893481.1.23329 WP_000893481.1.23409 WP_000893481.1.23442 WP_000893481.1.23444 WP_000893481.1.23460 WP_000893481.1.23472 WP_000893481.1.23482 WP_000893481.1.23500 WP_000893481.1.23503 WP_000893481.1.23529 WP_000893481.1.2358 WP_000893481.1.23621 WP_000893481.1.23629 WP_000893481.1.23631 WP_000893481.1.23670 WP_000893481.1.23675 WP_000893481.1.23685 WP_000893481.1.237 WP_000893481.1.23707 WP_000893481.1.23720 WP_000893481.1.23736 WP_000893481.1.23755 WP_000893481.1.2376 WP_000893481.1.2380 WP_000893481.1.23932 WP_000893481.1.23959 WP_000893481.1.24017 WP_000893481.1.24069 WP_000893481.1.24082 WP_000893481.1.24145 WP_000893481.1.2415 WP_000893481.1.24206 WP_000893481.1.24214 WP_000893481.1.24250 WP_000893481.1.24297 WP_000893481.1.24303 WP_000893481.1.24325 WP_000893481.1.24361 WP_000893481.1.24376 WP_000893481.1.24408 WP_000893481.1.24409 WP_000893481.1.24419 WP_000893481.1.24433 WP_000893481.1.24450 WP_000893481.1.24494 WP_000893481.1.24521 WP_000893481.1.24555 WP_000893481.1.2467 WP_000893481.1.24673 WP_000893481.1.24689 WP_000893481.1.24696 WP_000893481.1.24779 WP_000893481.1.24803 WP_000893481.1.24839 WP_000893481.1.24901 WP_000893481.1.24944 WP_000893481.1.25008 WP_000893481.1.25015 WP_000893481.1.25064 WP_000893481.1.25119 WP_000893481.1.25130 WP_000893481.1.25159 WP_000893481.1.25175 WP_000893481.1.25297 WP_000893481.1.25354 WP_000893481.1.25397 WP_000893481.1.25405 WP_000893481.1.25421 WP_000893481.1.25426 WP_000893481.1.25454 WP_000893481.1.25607 WP_000893481.1.25618 WP_000893481.1.25668 WP_000893481.1.25690 WP_000893481.1.25692 WP_000893481.1.2570 WP_000893481.1.25703 WP_000893481.1.25708 WP_000893481.1.25780 WP_000893481.1.25793 WP_000893481.1.25809 WP_000893481.1.2581 WP_000893481.1.25825 WP_000893481.1.25944 WP_000893481.1.25951 WP_000893481.1.25988 WP_000893481.1.26030 WP_000893481.1.26034 WP_000893481.1.26075 WP_000893481.1.26093 WP_000893481.1.26194 WP_000893481.1.26199 WP_000893481.1.26269 WP_000893481.1.26282 WP_000893481.1.26319 WP_000893481.1.26363 WP_000893481.1.26414 WP_000893481.1.26440 WP_000893481.1.26441 WP_000893481.1.26512 WP_000893481.1.26532 WP_000893481.1.26551 WP_000893481.1.26563 WP_000893481.1.26567 WP_000893481.1.26576 WP_000893481.1.26582 WP_000893481.1.2660 WP_000893481.1.26646 WP_000893481.1.2667 WP_000893481.1.26687 WP_000893481.1.26709 WP_000893481.1.2672 WP_000893481.1.26758 WP_000893481.1.26787 WP_000893481.1.26794 WP_000893481.1.26833 WP_000893481.1.26883 WP_000893481.1.26936 WP_000893481.1.26980 WP_000893481.1.27010 WP_000893481.1.27051 WP_000893481.1.27055 WP_000893481.1.27072 WP_000893481.1.27122 WP_000893481.1.27169 WP_000893481.1.27173 WP_000893481.1.272 WP_000893481.1.27223 WP_000893481.1.2723 WP_000893481.1.27383 WP_000893481.1.27452 WP_000893481.1.27522 WP_000893481.1.27523 WP_000893481.1.27547 WP_000893481.1.27616 WP_000893481.1.27632 WP_000893481.1.27658 WP_000893481.1.27665 WP_000893481.1.27707 WP_000893481.1.27713 WP_000893481.1.27761 WP_000893481.1.2777 WP_000893481.1.27800 WP_000893481.1.27815 WP_000893481.1.27833 WP_000893481.1.27883 WP_000893481.1.27892 WP_000893481.1.27969 WP_000893481.1.27995 WP_000893481.1.28037 WP_000893481.1.28056 WP_000893481.1.2806 WP_000893481.1.28094 WP_000893481.1.28116 WP_000893481.1.28139 WP_000893481.1.28174 WP_000893481.1.28200 WP_000893481.1.28225 WP_000893481.1.28232 WP_000893481.1.28233 WP_000893481.1.2829 WP_000893481.1.28302 WP_000893481.1.28303 WP_000893481.1.28393 WP_000893481.1.28462 WP_000893481.1.28504 WP_000893481.1.28514 WP_000893481.1.28612 WP_000893481.1.28620 WP_000893481.1.28625 WP_000893481.1.28665 WP_000893481.1.28673 WP_000893481.1.28694 WP_000893481.1.28733 WP_000893481.1.28773 WP_000893481.1.28775 WP_000893481.1.28830 WP_000893481.1.28902 WP_000893481.1.28921 WP_000893481.1.28946 WP_000893481.1.28977 WP_000893481.1.29010 WP_000893481.1.29099 WP_000893481.1.29113 WP_000893481.1.2915 WP_000893481.1.29168 WP_000893481.1.29218 WP_000893481.1.29255 WP_000893481.1.29265 WP_000893481.1.29274 WP_000893481.1.2932 WP_000893481.1.29349 WP_000893481.1.29379 WP_000893481.1.29422 WP_000893481.1.29436 WP_000893481.1.29576 WP_000893481.1.29601 WP_000893481.1.29682 WP_000893481.1.29711 WP_000893481.1.29774 WP_000893481.1.29775 WP_000893481.1.29827 WP_000893481.1.29924 WP_000893481.1.29969 WP_000893481.1.29990 WP_000893481.1.30018 WP_000893481.1.30027 WP_000893481.1.30059 WP_000893481.1.30165 WP_000893481.1.30179 WP_000893481.1.30195 WP_000893481.1.30213 WP_000893481.1.30238 WP_000893481.1.30246 WP_000893481.1.30331 WP_000893481.1.30356 WP_000893481.1.30386 WP_000893481.1.30425 WP_000893481.1.30469 WP_000893481.1.30492 WP_000893481.1.30505 WP_000893481.1.30535 WP_000893481.1.30547 WP_000893481.1.30548 WP_000893481.1.30555 WP_000893481.1.30589 WP_000893481.1.3067 WP_000893481.1.3068 WP_000893481.1.30752 WP_000893481.1.3076 WP_000893481.1.3080 WP_000893481.1.30802 WP_000893481.1.30803 WP_000893481.1.30819 WP_000893481.1.30823 WP_000893481.1.3089 WP_000893481.1.30934 WP_000893481.1.30968 WP_000893481.1.30972 WP_000893481.1.31 WP_000893481.1.31086 WP_000893481.1.31111 WP_000893481.1.31122 WP_000893481.1.31156 WP_000893481.1.31167 WP_000893481.1.31171 WP_000893481.1.31185 WP_000893481.1.3119 WP_000893481.1.31195 WP_000893481.1.31196 WP_000893481.1.31219 WP_000893481.1.3127 WP_000893481.1.31272 WP_000893481.1.31281 WP_000893481.1.31335 WP_000893481.1.31362 WP_000893481.1.31435 WP_000893481.1.31451 WP_000893481.1.31504 WP_000893481.1.31578 WP_000893481.1.31585 WP_000893481.1.31590 WP_000893481.1.31665 WP_000893481.1.3167 WP_000893481.1.3170 WP_000893481.1.31720 WP_000893481.1.31725 WP_000893481.1.31762 WP_000893481.1.31782 WP_000893481.1.31895 WP_000893481.1.31901 WP_000893481.1.31952 WP_000893481.1.31967 WP_000893481.1.31983 WP_000893481.1.3208 WP_000893481.1.32109 WP_000893481.1.32116 WP_000893481.1.32170 WP_000893481.1.32204 WP_000893481.1.32206 WP_000893481.1.32255 WP_000893481.1.32260 WP_000893481.1.32274 WP_000893481.1.32275 WP_000893481.1.32277 WP_000893481.1.32309 WP_000893481.1.32368 WP_000893481.1.32408 WP_000893481.1.32423 WP_000893481.1.32424 WP_000893481.1.32434 WP_000893481.1.32438 WP_000893481.1.32493 WP_000893481.1.32519 WP_000893481.1.32527 WP_000893481.1.32545 WP_000893481.1.32629 WP_000893481.1.32643 WP_000893481.1.32660 WP_000893481.1.32668 WP_000893481.1.32702 WP_000893481.1.32740 WP_000893481.1.32750 WP_000893481.1.3278 WP_000893481.1.32832 WP_000893481.1.32881 WP_000893481.1.32899 WP_000893481.1.32902 WP_000893481.1.32907 WP_000893481.1.32961 WP_000893481.1.32977 WP_000893481.1.33010 WP_000893481.1.3304 WP_000893481.1.33078 WP_000893481.1.33106 WP_000893481.1.33114 WP_000893481.1.33143 WP_000893481.1.33253 WP_000893481.1.33261 WP_000893481.1.33270 WP_000893481.1.33343 WP_000893481.1.33392 WP_000893481.1.33409 WP_000893481.1.33499 WP_000893481.1.335 WP_000893481.1.3356 WP_000893481.1.33580 WP_000893481.1.33586 WP_000893481.1.33592 WP_000893481.1.33609 WP_000893481.1.33629 WP_000893481.1.3364 WP_000893481.1.33786 WP_000893481.1.33825 WP_000893481.1.33865 WP_000893481.1.33894 WP_000893481.1.3394 WP_000893481.1.3396 WP_000893481.1.33986 WP_000893481.1.34022 WP_000893481.1.34075 WP_000893481.1.34084 WP_000893481.1.34091 WP_000893481.1.34179 WP_000893481.1.34184 WP_000893481.1.34185 WP_000893481.1.34259 WP_000893481.1.34279 WP_000893481.1.34292 WP_000893481.1.34364 WP_000893481.1.3438 WP_000893481.1.34417 WP_000893481.1.34431 WP_000893481.1.3445 WP_000893481.1.34453 WP_000893481.1.34454 WP_000893481.1.34458 WP_000893481.1.345 WP_000893481.1.34614 WP_000893481.1.34647 WP_000893481.1.34659 WP_000893481.1.34667 WP_000893481.1.34684 WP_000893481.1.34703 WP_000893481.1.34711 WP_000893481.1.34801 WP_000893481.1.34817 WP_000893481.1.34820 WP_000893481.1.34854 WP_000893481.1.34881 WP_000893481.1.34907 WP_000893481.1.34972 WP_000893481.1.35035 WP_000893481.1.35075 WP_000893481.1.35125 WP_000893481.1.35129 WP_000893481.1.35184 WP_000893481.1.35193 WP_000893481.1.35294 WP_000893481.1.35321 WP_000893481.1.35404 WP_000893481.1.35408 WP_000893481.1.3541 WP_000893481.1.35425 WP_000893481.1.35446 WP_000893481.1.35494 WP_000893481.1.35503 WP_000893481.1.35509 WP_000893481.1.35563 WP_000893481.1.35570 WP_000893481.1.35590 WP_000893481.1.35594 WP_000893481.1.35619 WP_000893481.1.35624 WP_000893481.1.35648 WP_000893481.1.3566 WP_000893481.1.35777 WP_000893481.1.35809 WP_000893481.1.35835 WP_000893481.1.35847 WP_000893481.1.35868 WP_000893481.1.35887 WP_000893481.1.35936 WP_000893481.1.35961 WP_000893481.1.35993 WP_000893481.1.36003 WP_000893481.1.36011 WP_000893481.1.36037 WP_000893481.1.36063 WP_000893481.1.3610 WP_000893481.1.36157 WP_000893481.1.36172 WP_000893481.1.36286 WP_000893481.1.36409 WP_000893481.1.36425 WP_000893481.1.36445 WP_000893481.1.36564 WP_000893481.1.36584 WP_000893481.1.36592 WP_000893481.1.36609 WP_000893481.1.36652 WP_000893481.1.36685 WP_000893481.1.3670 WP_000893481.1.36705 WP_000893481.1.36721 WP_000893481.1.36764 WP_000893481.1.36765 WP_000893481.1.3688 WP_000893481.1.36889 WP_000893481.1.36918 WP_000893481.1.36931 WP_000893481.1.36949 WP_000893481.1.37021 WP_000893481.1.37028 WP_000893481.1.37029 WP_000893481.1.37063 WP_000893481.1.37073 WP_000893481.1.37111 WP_000893481.1.37112 WP_000893481.1.37114 WP_000893481.1.37190 WP_000893481.1.37191 WP_000893481.1.37256 WP_000893481.1.3726 WP_000893481.1.37293 WP_000893481.1.37297 WP_000893481.1.3734 WP_000893481.1.37363 WP_000893481.1.37370 WP_000893481.1.37376 WP_000893481.1.37405 WP_000893481.1.3744 WP_000893481.1.3748 WP_000893481.1.37498 WP_000893481.1.3751 WP_000893481.1.37521 WP_000893481.1.37558 WP_000893481.1.3756 WP_000893481.1.37610 WP_000893481.1.37618 WP_000893481.1.3771 WP_000893481.1.37719 WP_000893481.1.3778 WP_000893481.1.37808 WP_000893481.1.37848 WP_000893481.1.37864 WP_000893481.1.3790 WP_000893481.1.37965 WP_000893481.1.38037 WP_000893481.1.38047 WP_000893481.1.38055 WP_000893481.1.38113 WP_000893481.1.38145 WP_000893481.1.3828 WP_000893481.1.38344 WP_000893481.1.38349 WP_000893481.1.38512 WP_000893481.1.38569 WP_000893481.1.38609 WP_000893481.1.38613 WP_000893481.1.38673 WP_000893481.1.38693 WP_000893481.1.38740 WP_000893481.1.38781 WP_000893481.1.38797 WP_000893481.1.38882 WP_000893481.1.38895 WP_000893481.1.38913 WP_000893481.1.38995 WP_000893481.1.39048 WP_000893481.1.39055 WP_000893481.1.39065 WP_000893481.1.39140 WP_000893481.1.39229 WP_000893481.1.39265 WP_000893481.1.39275 WP_000893481.1.39312 WP_000893481.1.39385 WP_000893481.1.39395 WP_000893481.1.39414 WP_000893481.1.39420 WP_000893481.1.39466 WP_000893481.1.39471 WP_000893481.1.39497 WP_000893481.1.39512 WP_000893481.1.39553 WP_000893481.1.39576 WP_000893481.1.39584 WP_000893481.1.39609 WP_000893481.1.39614 WP_000893481.1.39722 WP_000893481.1.39723 WP_000893481.1.39724 WP_000893481.1.39808 WP_000893481.1.39921 WP_000893481.1.39923 WP_000893481.1.40008 WP_000893481.1.40072 WP_000893481.1.40073 WP_000893481.1.40111 WP_000893481.1.40155 WP_000893481.1.40170 WP_000893481.1.40171 WP_000893481.1.40205 WP_000893481.1.40208 WP_000893481.1.40224 WP_000893481.1.40229 WP_000893481.1.40292 WP_000893481.1.40307 WP_000893481.1.40341 WP_000893481.1.40374 WP_000893481.1.40395 WP_000893481.1.40414 WP_000893481.1.40493 WP_000893481.1.40528 WP_000893481.1.40533 WP_000893481.1.40577 WP_000893481.1.40583 WP_000893481.1.40648 WP_000893481.1.40710 WP_000893481.1.4075 WP_000893481.1.40771 WP_000893481.1.40849 WP_000893481.1.4087 WP_000893481.1.40910 WP_000893481.1.40930 WP_000893481.1.40935 WP_000893481.1.40973 WP_000893481.1.40979 WP_000893481.1.40996 WP_000893481.1.41017 WP_000893481.1.41048 WP_000893481.1.41086 WP_000893481.1.41091 WP_000893481.1.41116 WP_000893481.1.41128 WP_000893481.1.4114 WP_000893481.1.41192 WP_000893481.1.41277 WP_000893481.1.41299 WP_000893481.1.41427 WP_000893481.1.41434 WP_000893481.1.41438 WP_000893481.1.41468 WP_000893481.1.41497 WP_000893481.1.41516 WP_000893481.1.41528 WP_000893481.1.41554 WP_000893481.1.41572 WP_000893481.1.41591 WP_000893481.1.41593 WP_000893481.1.41610 WP_000893481.1.41662 WP_000893481.1.41688 WP_000893481.1.41690 WP_000893481.1.41708 WP_000893481.1.41724 WP_000893481.1.41735 WP_000893481.1.41761 WP_000893481.1.4178 WP_000893481.1.41799 WP_000893481.1.41802 WP_000893481.1.4184 WP_000893481.1.41859 WP_000893481.1.41882 WP_000893481.1.41904 WP_000893481.1.41911 WP_000893481.1.41931 WP_000893481.1.41938 WP_000893481.1.41949 WP_000893481.1.41978 WP_000893481.1.41985 WP_000893481.1.41994 WP_000893481.1.41998 WP_000893481.1.42009 WP_000893481.1.42136 WP_000893481.1.422 WP_000893481.1.42244 WP_000893481.1.42262 WP_000893481.1.42263 WP_000893481.1.42276 WP_000893481.1.42322 WP_000893481.1.42328 WP_000893481.1.42342 WP_000893481.1.42356 WP_000893481.1.42392 WP_000893481.1.42394 WP_000893481.1.42422 WP_000893481.1.42444 WP_000893481.1.42453 WP_000893481.1.4257 WP_000893481.1.42595 WP_000893481.1.42605 WP_000893481.1.42666 WP_000893481.1.42675 WP_000893481.1.42676 WP_000893481.1.42683 WP_000893481.1.42707 WP_000893481.1.42797 WP_000893481.1.42861 WP_000893481.1.42864 WP_000893481.1.4288 WP_000893481.1.4289 WP_000893481.1.42892 WP_000893481.1.42923 WP_000893481.1.42932 WP_000893481.1.42957 WP_000893481.1.42981 WP_000893481.1.43018 WP_000893481.1.43041 WP_000893481.1.43070 WP_000893481.1.43077 WP_000893481.1.43086 WP_000893481.1.43126 WP_000893481.1.43149 WP_000893481.1.43201 WP_000893481.1.43276 WP_000893481.1.43312 WP_000893481.1.4332 WP_000893481.1.43339 WP_000893481.1.4344 WP_000893481.1.43522 WP_000893481.1.43528 WP_000893481.1.43535 WP_000893481.1.43606 WP_000893481.1.43613 WP_000893481.1.43676 WP_000893481.1.43685 WP_000893481.1.43710 WP_000893481.1.43711 WP_000893481.1.4373 WP_000893481.1.43782 WP_000893481.1.43785 WP_000893481.1.43828 WP_000893481.1.43839 WP_000893481.1.43864 WP_000893481.1.43873 WP_000893481.1.43875 WP_000893481.1.43886 WP_000893481.1.44005 WP_000893481.1.44010 WP_000893481.1.4404 WP_000893481.1.44063 WP_000893481.1.44099 WP_000893481.1.44121 WP_000893481.1.44132 WP_000893481.1.44144 WP_000893481.1.44187 WP_000893481.1.4422 WP_000893481.1.44300 WP_000893481.1.44310 WP_000893481.1.44337 WP_000893481.1.44339 WP_000893481.1.44359 WP_000893481.1.44433 WP_000893481.1.44438 WP_000893481.1.44440 WP_000893481.1.44453 WP_000893481.1.44474 WP_000893481.1.44578 WP_000893481.1.44633 WP_000893481.1.44636 WP_000893481.1.44640 WP_000893481.1.44705 WP_000893481.1.44747 WP_000893481.1.44781 WP_000893481.1.44791 WP_000893481.1.44831 WP_000893481.1.4485 WP_000893481.1.449 WP_000893481.1.44927 WP_000893481.1.44933 WP_000893481.1.44943 WP_000893481.1.44950 WP_000893481.1.44966 WP_000893481.1.44978 WP_000893481.1.44996 WP_000893481.1.4500 WP_000893481.1.45038 WP_000893481.1.45045 WP_000893481.1.45067 WP_000893481.1.45079 WP_000893481.1.45098 WP_000893481.1.45123 WP_000893481.1.45134 WP_000893481.1.45145 WP_000893481.1.45173 WP_000893481.1.45184 WP_000893481.1.45238 WP_000893481.1.45268 WP_000893481.1.45302 WP_000893481.1.4531 WP_000893481.1.45322 WP_000893481.1.45344 WP_000893481.1.45351 WP_000893481.1.45365 WP_000893481.1.4540 WP_000893481.1.45402 WP_000893481.1.45432 WP_000893481.1.45462 WP_000893481.1.45468 WP_000893481.1.45522 WP_000893481.1.45535 WP_000893481.1.45544 WP_000893481.1.45549 WP_000893481.1.45550 WP_000893481.1.45566 WP_000893481.1.45569 WP_000893481.1.45571 WP_000893481.1.45583 WP_000893481.1.45622 WP_000893481.1.45706 WP_000893481.1.45797 WP_000893481.1.458 WP_000893481.1.45844 WP_000893481.1.45906 WP_000893481.1.45918 WP_000893481.1.4592 WP_000893481.1.45973 WP_000893481.1.45984 WP_000893481.1.46011 WP_000893481.1.46091 WP_000893481.1.46112 WP_000893481.1.46173 WP_000893481.1.46203 WP_000893481.1.46205 WP_000893481.1.46215 WP_000893481.1.46286 WP_000893481.1.46303 WP_000893481.1.46322 WP_000893481.1.46323 WP_000893481.1.46345 WP_000893481.1.46358 WP_000893481.1.46406 WP_000893481.1.46434 WP_000893481.1.46444 WP_000893481.1.46499 WP_000893481.1.46572 WP_000893481.1.46578 WP_000893481.1.46620 WP_000893481.1.46637 WP_000893481.1.46675 WP_000893481.1.46689 WP_000893481.1.46693 WP_000893481.1.4671 WP_000893481.1.46726 WP_000893481.1.46730 WP_000893481.1.46732 WP_000893481.1.4674 WP_000893481.1.46749 WP_000893481.1.46803 WP_000893481.1.46804 WP_000893481.1.4686 WP_000893481.1.46930 WP_000893481.1.46961 WP_000893481.1.46967 WP_000893481.1.46975 WP_000893481.1.46976 WP_000893481.1.47005 WP_000893481.1.47008 WP_000893481.1.47023 WP_000893481.1.47214 WP_000893481.1.47257 WP_000893481.1.47389 WP_000893481.1.47429 WP_000893481.1.47448 WP_000893481.1.47460 WP_000893481.1.47478 WP_000893481.1.47492 WP_000893481.1.47567 WP_000893481.1.47576 WP_000893481.1.47579 WP_000893481.1.4758 WP_000893481.1.47614 WP_000893481.1.47714 WP_000893481.1.4775 WP_000893481.1.47799 WP_000893481.1.47814 WP_000893481.1.47829 WP_000893481.1.47849 WP_000893481.1.47850 WP_000893481.1.47875 WP_000893481.1.47902 WP_000893481.1.47911 WP_000893481.1.47928 WP_000893481.1.4795 WP_000893481.1.47988 WP_000893481.1.47992 WP_000893481.1.48132 WP_000893481.1.48209 WP_000893481.1.48242 WP_000893481.1.48244 WP_000893481.1.48247 WP_000893481.1.48253 WP_000893481.1.48268 WP_000893481.1.483 WP_000893481.1.48342 WP_000893481.1.48377 WP_000893481.1.4839 WP_000893481.1.48399 WP_000893481.1.4853 WP_000893481.1.48570 WP_000893481.1.48647 WP_000893481.1.48755 WP_000893481.1.48788 WP_000893481.1.48797 WP_000893481.1.4885 WP_000893481.1.48855 WP_000893481.1.48886 WP_000893481.1.48894 WP_000893481.1.48896 WP_000893481.1.48918 WP_000893481.1.48919 WP_000893481.1.48931 WP_000893481.1.48985 WP_000893481.1.49005 WP_000893481.1.49012 WP_000893481.1.49102 WP_000893481.1.49113 WP_000893481.1.49155 WP_000893481.1.49214 WP_000893481.1.49226 WP_000893481.1.49233 WP_000893481.1.49239 WP_000893481.1.49262 WP_000893481.1.49274 WP_000893481.1.49290 WP_000893481.1.49302 WP_000893481.1.49304 WP_000893481.1.49311 WP_000893481.1.49334 WP_000893481.1.49358 WP_000893481.1.49366 WP_000893481.1.49472 WP_000893481.1.49490 WP_000893481.1.49515 WP_000893481.1.49572 WP_000893481.1.49590 WP_000893481.1.49630 WP_000893481.1.49686 WP_000893481.1.49770 WP_000893481.1.49778 WP_000893481.1.49827 WP_000893481.1.49848 WP_000893481.1.49931 WP_000893481.1.50007 WP_000893481.1.50080 WP_000893481.1.5009 WP_000893481.1.50161 WP_000893481.1.50198 WP_000893481.1.50238 WP_000893481.1.50251 WP_000893481.1.50332 WP_000893481.1.50349 WP_000893481.1.50376 WP_000893481.1.50386 WP_000893481.1.50389 WP_000893481.1.50404 WP_000893481.1.50413 WP_000893481.1.50469 WP_000893481.1.50478 WP_000893481.1.50497 WP_000893481.1.50565 WP_000893481.1.5058 WP_000893481.1.50593 WP_000893481.1.50652 WP_000893481.1.50676 WP_000893481.1.50684 WP_000893481.1.50769 WP_000893481.1.50777 WP_000893481.1.50782 WP_000893481.1.50800 WP_000893481.1.50804 WP_000893481.1.50811 WP_000893481.1.5088 WP_000893481.1.50882 WP_000893481.1.50893 WP_000893481.1.50908 WP_000893481.1.50918 WP_000893481.1.50941 WP_000893481.1.50954 WP_000893481.1.50960 WP_000893481.1.51014 WP_000893481.1.51022 WP_000893481.1.51066 WP_000893481.1.51117 WP_000893481.1.51131 WP_000893481.1.51139 WP_000893481.1.5114 WP_000893481.1.51162 WP_000893481.1.51179 WP_000893481.1.51182 WP_000893481.1.51186 WP_000893481.1.5125 WP_000893481.1.51285 WP_000893481.1.51308 WP_000893481.1.51331 WP_000893481.1.51338 WP_000893481.1.51356 WP_000893481.1.5138 WP_000893481.1.51414 WP_000893481.1.51419 WP_000893481.1.51451 WP_000893481.1.51464 WP_000893481.1.51506 WP_000893481.1.51514 WP_000893481.1.51555 WP_000893481.1.51594 WP_000893481.1.51611 WP_000893481.1.51615 WP_000893481.1.51634 WP_000893481.1.51642 WP_000893481.1.51649 WP_000893481.1.51704 WP_000893481.1.51764 WP_000893481.1.51810 WP_000893481.1.51868 WP_000893481.1.51910 WP_000893481.1.51911 WP_000893481.1.51930 WP_000893481.1.51989 WP_000893481.1.51994 WP_000893481.1.520 WP_000893481.1.5211 WP_000893481.1.52123 WP_000893481.1.52148 WP_000893481.1.5216 WP_000893481.1.52161 WP_000893481.1.52170 WP_000893481.1.52301 WP_000893481.1.52321 WP_000893481.1.52336 WP_000893481.1.52346 WP_000893481.1.52361 WP_000893481.1.52438 WP_000893481.1.52446 WP_000893481.1.52527 WP_000893481.1.52582 WP_000893481.1.52586 WP_000893481.1.52608 WP_000893481.1.52637 WP_000893481.1.52692 WP_000893481.1.52738 WP_000893481.1.52744 WP_000893481.1.52833 WP_000893481.1.52851 WP_000893481.1.52857 WP_000893481.1.52858 WP_000893481.1.52866 WP_000893481.1.52898 WP_000893481.1.52924 WP_000893481.1.52949 WP_000893481.1.52985 WP_000893481.1.53016 WP_000893481.1.53107 WP_000893481.1.53119 WP_000893481.1.5313 WP_000893481.1.53179 WP_000893481.1.53190 WP_000893481.1.53198 WP_000893481.1.53206 WP_000893481.1.53234 WP_000893481.1.53315 WP_000893481.1.53316 WP_000893481.1.53328 WP_000893481.1.53466 WP_000893481.1.53534 WP_000893481.1.53567 WP_000893481.1.53664 WP_000893481.1.53694 WP_000893481.1.53696 WP_000893481.1.53772 WP_000893481.1.53778 WP_000893481.1.53781 WP_000893481.1.53790 WP_000893481.1.53896 WP_000893481.1.53905 WP_000893481.1.5392 WP_000893481.1.54033 WP_000893481.1.54061 WP_000893481.1.54068 WP_000893481.1.54085 WP_000893481.1.54136 WP_000893481.1.5415 WP_000893481.1.54209 WP_000893481.1.54271 WP_000893481.1.54273 WP_000893481.1.54283 WP_000893481.1.54319 WP_000893481.1.54364 WP_000893481.1.54366 WP_000893481.1.54400 WP_000893481.1.54500 WP_000893481.1.54522 WP_000893481.1.54526 WP_000893481.1.54569 WP_000893481.1.54615 WP_000893481.1.54644 WP_000893481.1.54662 WP_000893481.1.54722 WP_000893481.1.54764 WP_000893481.1.54774 WP_000893481.1.54845 WP_000893481.1.5485 WP_000893481.1.54877 WP_000893481.1.54936 WP_000893481.1.54992 WP_000893481.1.55008 WP_000893481.1.55152 WP_000893481.1.55156 WP_000893481.1.55166 WP_000893481.1.5517 WP_000893481.1.55178 WP_000893481.1.55223 WP_000893481.1.55224 WP_000893481.1.5523 WP_000893481.1.5525 WP_000893481.1.55285 WP_000893481.1.55418 WP_000893481.1.55430 WP_000893481.1.55461 WP_000893481.1.55475 WP_000893481.1.55496 WP_000893481.1.55500 WP_000893481.1.5552 WP_000893481.1.55528 WP_000893481.1.5555 WP_000893481.1.55554 WP_000893481.1.55557 WP_000893481.1.55559 WP_000893481.1.5560 WP_000893481.1.55614 WP_000893481.1.55640 WP_000893481.1.55672 WP_000893481.1.55680 WP_000893481.1.55706 WP_000893481.1.5572 WP_000893481.1.55768 WP_000893481.1.55782 WP_000893481.1.55923 WP_000893481.1.55948 WP_000893481.1.55973 WP_000893481.1.55995 WP_000893481.1.56026 WP_000893481.1.56069 WP_000893481.1.56082 WP_000893481.1.56100 WP_000893481.1.56105 WP_000893481.1.56130 WP_000893481.1.56222 WP_000893481.1.56235 WP_000893481.1.56261 WP_000893481.1.56263 WP_000893481.1.56286 WP_000893481.1.56304 WP_000893481.1.5633 WP_000893481.1.56354 WP_000893481.1.56368 WP_000893481.1.56385 WP_000893481.1.56389 WP_000893481.1.56413 WP_000893481.1.56420 WP_000893481.1.56438 WP_000893481.1.56459 WP_000893481.1.56559 WP_000893481.1.56601 WP_000893481.1.56615 WP_000893481.1.56642 WP_000893481.1.56671 WP_000893481.1.5668 WP_000893481.1.56851 WP_000893481.1.56875 WP_000893481.1.56877 WP_000893481.1.56893 WP_000893481.1.56898 WP_000893481.1.56905 WP_000893481.1.56950 WP_000893481.1.57000 WP_000893481.1.57026 WP_000893481.1.57056 WP_000893481.1.57076 WP_000893481.1.57084 WP_000893481.1.5711 WP_000893481.1.57125 WP_000893481.1.57168 WP_000893481.1.57233 WP_000893481.1.57246 WP_000893481.1.57296 WP_000893481.1.57307 WP_000893481.1.57344 WP_000893481.1.57356 WP_000893481.1.57357 WP_000893481.1.57362 WP_000893481.1.57399 WP_000893481.1.57418 WP_000893481.1.57521 WP_000893481.1.5753 WP_000893481.1.57534 WP_000893481.1.57555 WP_000893481.1.57559 WP_000893481.1.57576 WP_000893481.1.57601 WP_000893481.1.57607 WP_000893481.1.5761 WP_000893481.1.57631 WP_000893481.1.57641 WP_000893481.1.57709 WP_000893481.1.57710 WP_000893481.1.57735 WP_000893481.1.5774 WP_000893481.1.57797 WP_000893481.1.57835 WP_000893481.1.57862 WP_000893481.1.57891 WP_000893481.1.57902 WP_000893481.1.58053 WP_000893481.1.58090 WP_000893481.1.58131 WP_000893481.1.58153 WP_000893481.1.58239 WP_000893481.1.58249 WP_000893481.1.5828 WP_000893481.1.58290 WP_000893481.1.58301 WP_000893481.1.58334 WP_000893481.1.58416 WP_000893481.1.58418 WP_000893481.1.58442 WP_000893481.1.58443 WP_000893481.1.58451 WP_000893481.1.5846 WP_000893481.1.58486 WP_000893481.1.58489 WP_000893481.1.5854 WP_000893481.1.58548 WP_000893481.1.5858 WP_000893481.1.58604 WP_000893481.1.58633 WP_000893481.1.58648 WP_000893481.1.58662 WP_000893481.1.58675 WP_000893481.1.587 WP_000893481.1.58729 WP_000893481.1.58744 WP_000893481.1.58745 WP_000893481.1.58803 WP_000893481.1.58831 WP_000893481.1.58834 WP_000893481.1.5886 WP_000893481.1.58861 WP_000893481.1.58926 WP_000893481.1.59006 WP_000893481.1.5907 WP_000893481.1.59094 WP_000893481.1.59136 WP_000893481.1.59142 WP_000893481.1.59148 WP_000893481.1.59163 WP_000893481.1.59224 WP_000893481.1.59294 WP_000893481.1.59295 WP_000893481.1.59336 WP_000893481.1.59375 WP_000893481.1.59381 WP_000893481.1.59412 WP_000893481.1.59427 WP_000893481.1.59458 WP_000893481.1.59508 WP_000893481.1.59521 WP_000893481.1.59538 WP_000893481.1.59548 WP_000893481.1.59562 WP_000893481.1.59587 WP_000893481.1.59636 WP_000893481.1.59641 WP_000893481.1.59646 WP_000893481.1.59648 WP_000893481.1.59684 WP_000893481.1.59694 WP_000893481.1.59709 WP_000893481.1.59755 WP_000893481.1.59771 WP_000893481.1.59848 WP_000893481.1.59928 WP_000893481.1.59933 WP_000893481.1.60015 WP_000893481.1.60021 WP_000893481.1.60052 WP_000893481.1.60069 WP_000893481.1.60126 WP_000893481.1.60137 WP_000893481.1.60209 WP_000893481.1.60213 WP_000893481.1.60231 WP_000893481.1.60285 WP_000893481.1.60320 WP_000893481.1.6033 WP_000893481.1.60330 WP_000893481.1.60379 WP_000893481.1.60425 WP_000893481.1.60469 WP_000893481.1.60486 WP_000893481.1.60503 WP_000893481.1.60560 WP_000893481.1.60561 WP_000893481.1.60608 WP_000893481.1.60622 WP_000893481.1.60661 WP_000893481.1.60713 WP_000893481.1.60746 WP_000893481.1.60772 WP_000893481.1.60794 WP_000893481.1.608 WP_000893481.1.60851 WP_000893481.1.60855 WP_000893481.1.60857 WP_000893481.1.6086 WP_000893481.1.60874 WP_000893481.1.60897 WP_000893481.1.60930 WP_000893481.1.60988 WP_000893481.1.60990 WP_000893481.1.61045 WP_000893481.1.61078 WP_000893481.1.61087 WP_000893481.1.6114 WP_000893481.1.61146 WP_000893481.1.61201 WP_000893481.1.61218 WP_000893481.1.61232 WP_000893481.1.6126 WP_000893481.1.61356 WP_000893481.1.61381 WP_000893481.1.61417 WP_000893481.1.61497 WP_000893481.1.61509 WP_000893481.1.61519 WP_000893481.1.61574 WP_000893481.1.61582 WP_000893481.1.61594 WP_000893481.1.61595 WP_000893481.1.6164 WP_000893481.1.61671 WP_000893481.1.61712 WP_000893481.1.61714 WP_000893481.1.61732 WP_000893481.1.61857 WP_000893481.1.61908 WP_000893481.1.61918 WP_000893481.1.61922 WP_000893481.1.61924 WP_000893481.1.61968 WP_000893481.1.62007 WP_000893481.1.62020 WP_000893481.1.62076 WP_000893481.1.6210 WP_000893481.1.62120 WP_000893481.1.62122 WP_000893481.1.62142 WP_000893481.1.62144 WP_000893481.1.62158 WP_000893481.1.62184 WP_000893481.1.62201 WP_000893481.1.62210 WP_000893481.1.62219 WP_000893481.1.62222 WP_000893481.1.62245 WP_000893481.1.62257 WP_000893481.1.62271 WP_000893481.1.62304 WP_000893481.1.62339 WP_000893481.1.62361 WP_000893481.1.62407 WP_000893481.1.62412 WP_000893481.1.62486 WP_000893481.1.62488 WP_000893481.1.62522 WP_000893481.1.62619 WP_000893481.1.62648 WP_000893481.1.62669 WP_000893481.1.62693 WP_000893481.1.627 WP_000893481.1.62745 WP_000893481.1.62757 WP_000893481.1.62853 WP_000893481.1.62903 WP_000893481.1.62910 WP_000893481.1.6292 WP_000893481.1.62955 WP_000893481.1.62976 WP_000893481.1.62983 WP_000893481.1.62988 WP_000893481.1.63045 WP_000893481.1.63102 WP_000893481.1.63129 WP_000893481.1.63181 WP_000893481.1.63229 WP_000893481.1.63256 WP_000893481.1.63358 WP_000893481.1.63362 WP_000893481.1.63382 WP_000893481.1.63422 WP_000893481.1.63432 WP_000893481.1.63461 WP_000893481.1.63479 WP_000893481.1.63497 WP_000893481.1.63499 WP_000893481.1.63509 WP_000893481.1.63525 WP_000893481.1.63529 WP_000893481.1.63548 WP_000893481.1.6357 WP_000893481.1.63577 WP_000893481.1.63603 WP_000893481.1.63633 WP_000893481.1.63664 WP_000893481.1.63677 WP_000893481.1.63690 WP_000893481.1.63718 WP_000893481.1.63748 WP_000893481.1.6375 WP_000893481.1.63766 WP_000893481.1.63781 WP_000893481.1.63782 WP_000893481.1.63797 WP_000893481.1.63824 WP_000893481.1.63831 WP_000893481.1.63851 WP_000893481.1.63863 WP_000893481.1.63864 WP_000893481.1.63866 WP_000893481.1.63912 WP_000893481.1.63958 WP_000893481.1.63977 WP_000893481.1.6399 WP_000893481.1.63992 WP_000893481.1.64007 WP_000893481.1.64010 WP_000893481.1.64034 WP_000893481.1.64036 WP_000893481.1.64046 WP_000893481.1.64085 WP_000893481.1.64109 WP_000893481.1.64157 WP_000893481.1.64208 WP_000893481.1.64229 WP_000893481.1.6423 WP_000893481.1.64244 WP_000893481.1.64350 WP_000893481.1.64385 WP_000893481.1.64387 WP_000893481.1.64389 WP_000893481.1.64403 WP_000893481.1.64462 WP_000893481.1.64500 WP_000893481.1.6451 WP_000893481.1.64569 WP_000893481.1.64597 WP_000893481.1.64649 WP_000893481.1.64674 WP_000893481.1.64690 WP_000893481.1.64702 WP_000893481.1.64711 WP_000893481.1.64715 WP_000893481.1.64757 WP_000893481.1.64781 WP_000893481.1.64831 WP_000893481.1.6489 WP_000893481.1.64894 WP_000893481.1.64920 WP_000893481.1.64944 WP_000893481.1.65011 WP_000893481.1.65027 WP_000893481.1.65028 WP_000893481.1.65052 WP_000893481.1.65168 WP_000893481.1.65185 WP_000893481.1.65248 WP_000893481.1.6525 WP_000893481.1.65269 WP_000893481.1.65348 WP_000893481.1.6535 WP_000893481.1.65357 WP_000893481.1.65474 WP_000893481.1.65538 WP_000893481.1.65558 WP_000893481.1.65572 WP_000893481.1.6560 WP_000893481.1.65601 WP_000893481.1.6561 WP_000893481.1.65633 WP_000893481.1.6565 WP_000893481.1.65687 WP_000893481.1.65698 WP_000893481.1.6575 WP_000893481.1.65771 WP_000893481.1.65782 WP_000893481.1.65790 WP_000893481.1.65838 WP_000893481.1.65876 WP_000893481.1.65881 WP_000893481.1.65883 WP_000893481.1.65901 WP_000893481.1.6594 WP_000893481.1.6595 WP_000893481.1.65956 WP_000893481.1.65968 WP_000893481.1.66049 WP_000893481.1.66074 WP_000893481.1.66082 WP_000893481.1.66122 WP_000893481.1.66129 WP_000893481.1.66171 WP_000893481.1.66235 WP_000893481.1.66250 WP_000893481.1.66270 WP_000893481.1.66289 WP_000893481.1.66315 WP_000893481.1.66330 WP_000893481.1.66358 WP_000893481.1.66365 WP_000893481.1.66385 WP_000893481.1.6640 WP_000893481.1.66400 WP_000893481.1.66428 WP_000893481.1.66446 WP_000893481.1.66462 WP_000893481.1.66539 WP_000893481.1.66600 WP_000893481.1.66678 WP_000893481.1.66698 WP_000893481.1.66702 WP_000893481.1.66733 WP_000893481.1.6680 WP_000893481.1.66800 WP_000893481.1.66807 WP_000893481.1.66820 WP_000893481.1.66824 WP_000893481.1.66825 WP_000893481.1.66901 WP_000893481.1.6692 WP_000893481.1.66937 WP_000893481.1.66959 WP_000893481.1.67037 WP_000893481.1.67045 WP_000893481.1.67075 WP_000893481.1.6710 WP_000893481.1.67100 WP_000893481.1.67173 WP_000893481.1.67279 WP_000893481.1.67374 WP_000893481.1.6739 WP_000893481.1.67424 WP_000893481.1.67465 WP_000893481.1.67552 WP_000893481.1.6760 WP_000893481.1.67603 WP_000893481.1.67623 WP_000893481.1.67633 WP_000893481.1.67705 WP_000893481.1.67707 WP_000893481.1.67731 WP_000893481.1.67776 WP_000893481.1.67803 WP_000893481.1.67814 WP_000893481.1.6782 WP_000893481.1.67829 WP_000893481.1.67905 WP_000893481.1.67932 WP_000893481.1.67942 WP_000893481.1.67969 WP_000893481.1.67970 WP_000893481.1.67977 WP_000893481.1.68073 WP_000893481.1.68115 WP_000893481.1.68140 WP_000893481.1.68147 WP_000893481.1.68159 WP_000893481.1.68167 WP_000893481.1.68201 WP_000893481.1.68210 WP_000893481.1.6833 WP_000893481.1.68401 WP_000893481.1.68477 WP_000893481.1.68478 WP_000893481.1.68532 WP_000893481.1.68547 WP_000893481.1.6857 WP_000893481.1.68589 WP_000893481.1.68652 WP_000893481.1.68655 WP_000893481.1.68656 WP_000893481.1.68658 WP_000893481.1.68677 WP_000893481.1.6869 WP_000893481.1.68778 WP_000893481.1.6882 WP_000893481.1.6883 WP_000893481.1.68895 WP_000893481.1.68958 WP_000893481.1.68966 WP_000893481.1.68999 WP_000893481.1.69001 WP_000893481.1.69006 WP_000893481.1.69011 WP_000893481.1.69042 WP_000893481.1.6905 WP_000893481.1.69080 WP_000893481.1.69086 WP_000893481.1.6913 WP_000893481.1.69151 WP_000893481.1.69236 WP_000893481.1.69255 WP_000893481.1.69320 WP_000893481.1.69359 WP_000893481.1.69485 WP_000893481.1.69515 WP_000893481.1.6954 WP_000893481.1.69554 WP_000893481.1.69564 WP_000893481.1.69575 WP_000893481.1.69588 WP_000893481.1.69597 WP_000893481.1.69616 WP_000893481.1.69696 WP_000893481.1.69754 WP_000893481.1.69758 WP_000893481.1.69760 WP_000893481.1.69767 WP_000893481.1.69787 WP_000893481.1.69790 WP_000893481.1.69890 WP_000893481.1.69965 WP_000893481.1.69975 WP_000893481.1.69977 WP_000893481.1.70003 WP_000893481.1.70028 WP_000893481.1.70087 WP_000893481.1.70088 WP_000893481.1.7016 WP_000893481.1.70169 WP_000893481.1.7021 WP_000893481.1.70241 WP_000893481.1.70248 WP_000893481.1.70269 WP_000893481.1.70281 WP_000893481.1.70289 WP_000893481.1.70321 WP_000893481.1.70327 WP_000893481.1.70355 WP_000893481.1.70440 WP_000893481.1.70447 WP_000893481.1.70485 WP_000893481.1.70531 WP_000893481.1.70580 WP_000893481.1.70596 WP_000893481.1.70643 WP_000893481.1.70662 WP_000893481.1.70678 WP_000893481.1.70683 WP_000893481.1.70732 WP_000893481.1.70785 WP_000893481.1.70837 WP_000893481.1.70883 WP_000893481.1.70899 WP_000893481.1.70914 WP_000893481.1.70929 WP_000893481.1.7093 WP_000893481.1.70959 WP_000893481.1.70985 WP_000893481.1.71010 WP_000893481.1.71023 WP_000893481.1.71069 WP_000893481.1.71088 WP_000893481.1.7110 WP_000893481.1.71116 WP_000893481.1.71146 WP_000893481.1.71150 WP_000893481.1.71165 WP_000893481.1.71184 WP_000893481.1.71188 WP_000893481.1.71201 WP_000893481.1.71202 WP_000893481.1.71305 WP_000893481.1.71306 WP_000893481.1.71337 WP_000893481.1.71363 WP_000893481.1.71378 WP_000893481.1.714 WP_000893481.1.71500 WP_000893481.1.71600 WP_000893481.1.71626 WP_000893481.1.71636 WP_000893481.1.71649 WP_000893481.1.71691 WP_000893481.1.71702 WP_000893481.1.7174 WP_000893481.1.71746 WP_000893481.1.71845 WP_000893481.1.71908 WP_000893481.1.71923 WP_000893481.1.71929 WP_000893481.1.71973 WP_000893481.1.71979 WP_000893481.1.71984 WP_000893481.1.720 WP_000893481.1.72068 WP_000893481.1.72100 WP_000893481.1.72105 WP_000893481.1.72107 WP_000893481.1.72182 WP_000893481.1.72203 WP_000893481.1.72220 WP_000893481.1.72221 WP_000893481.1.72226 WP_000893481.1.72277 WP_000893481.1.72281 WP_000893481.1.72300 WP_000893481.1.72325 WP_000893481.1.72339 WP_000893481.1.72351 WP_000893481.1.72376 WP_000893481.1.72412 WP_000893481.1.7243 WP_000893481.1.72470 WP_000893481.1.72532 WP_000893481.1.72594 WP_000893481.1.72602 WP_000893481.1.72625 WP_000893481.1.72629 WP_000893481.1.72642 WP_000893481.1.72671 WP_000893481.1.72716 WP_000893481.1.72718 WP_000893481.1.72793 WP_000893481.1.72797 WP_000893481.1.72827 WP_000893481.1.72843 WP_000893481.1.72850 WP_000893481.1.72865 WP_000893481.1.72871 WP_000893481.1.72872 WP_000893481.1.72887 WP_000893481.1.72894 WP_000893481.1.7295 WP_000893481.1.73068 WP_000893481.1.73125 WP_000893481.1.7315 WP_000893481.1.73200 WP_000893481.1.73242 WP_000893481.1.73270 WP_000893481.1.73328 WP_000893481.1.73338 WP_000893481.1.73362 WP_000893481.1.73377 WP_000893481.1.73379 WP_000893481.1.73461 WP_000893481.1.73481 WP_000893481.1.73512 WP_000893481.1.73561 WP_000893481.1.73617 WP_000893481.1.73669 WP_000893481.1.73708 WP_000893481.1.7374 WP_000893481.1.73753 WP_000893481.1.73758 WP_000893481.1.73764 WP_000893481.1.73794 WP_000893481.1.73804 WP_000893481.1.73847 WP_000893481.1.7386 WP_000893481.1.73901 WP_000893481.1.73924 WP_000893481.1.73926 WP_000893481.1.7394 WP_000893481.1.73945 WP_000893481.1.73965 WP_000893481.1.74029 WP_000893481.1.74049 WP_000893481.1.7405 WP_000893481.1.74117 WP_000893481.1.74174 WP_000893481.1.74207 WP_000893481.1.74228 WP_000893481.1.74248 WP_000893481.1.74300 WP_000893481.1.7433 WP_000893481.1.74379 WP_000893481.1.74402 WP_000893481.1.74410 WP_000893481.1.74414 WP_000893481.1.74422 WP_000893481.1.74428 WP_000893481.1.74466 WP_000893481.1.74481 WP_000893481.1.74545 WP_000893481.1.74578 WP_000893481.1.7458 WP_000893481.1.74620 WP_000893481.1.74673 WP_000893481.1.74745 WP_000893481.1.74884 WP_000893481.1.7491 WP_000893481.1.74946 WP_000893481.1.75051 WP_000893481.1.75056 WP_000893481.1.75058 WP_000893481.1.75134 WP_000893481.1.75148 WP_000893481.1.75159 WP_000893481.1.75168 WP_000893481.1.75187 WP_000893481.1.75288 WP_000893481.1.75301 WP_000893481.1.75334 WP_000893481.1.75362 WP_000893481.1.75385 WP_000893481.1.75400 WP_000893481.1.75450 WP_000893481.1.7558 WP_000893481.1.75609 WP_000893481.1.75626 WP_000893481.1.7563 WP_000893481.1.75664 WP_000893481.1.75703 WP_000893481.1.75716 WP_000893481.1.75740 WP_000893481.1.75751 WP_000893481.1.75764 WP_000893481.1.75794 WP_000893481.1.75810 WP_000893481.1.75863 WP_000893481.1.75902 WP_000893481.1.75919 WP_000893481.1.75945 WP_000893481.1.75957 WP_000893481.1.76 WP_000893481.1.76020 WP_000893481.1.76024 WP_000893481.1.76055 WP_000893481.1.76097 WP_000893481.1.76102 WP_000893481.1.76108 WP_000893481.1.76137 WP_000893481.1.76156 WP_000893481.1.76162 WP_000893481.1.76164 WP_000893481.1.76186 WP_000893481.1.76252 WP_000893481.1.76301 WP_000893481.1.76327 WP_000893481.1.7633 WP_000893481.1.76345 WP_000893481.1.76364 WP_000893481.1.76445 WP_000893481.1.76451 WP_000893481.1.76495 WP_000893481.1.76516 WP_000893481.1.76529 WP_000893481.1.76532 WP_000893481.1.7655 WP_000893481.1.7657 WP_000893481.1.7660 WP_000893481.1.76611 WP_000893481.1.76673 WP_000893481.1.76706 WP_000893481.1.7672 WP_000893481.1.76721 WP_000893481.1.76799 WP_000893481.1.76806 WP_000893481.1.7684 WP_000893481.1.76866 WP_000893481.1.76875 WP_000893481.1.76913 WP_000893481.1.76968 WP_000893481.1.77017 WP_000893481.1.77033 WP_000893481.1.77047 WP_000893481.1.77067 WP_000893481.1.7712 WP_000893481.1.77177 WP_000893481.1.77184 WP_000893481.1.77267 WP_000893481.1.77271 WP_000893481.1.77292 WP_000893481.1.77306 WP_000893481.1.77356 WP_000893481.1.77390 WP_000893481.1.77414 WP_000893481.1.77440 WP_000893481.1.77475 WP_000893481.1.77496 WP_000893481.1.77529 WP_000893481.1.77543 WP_000893481.1.77549 WP_000893481.1.77555 WP_000893481.1.77575 WP_000893481.1.77622 WP_000893481.1.77646 WP_000893481.1.77692 WP_000893481.1.77710 WP_000893481.1.77761 WP_000893481.1.7782 WP_000893481.1.77871 WP_000893481.1.77918 WP_000893481.1.7792 WP_000893481.1.77951 WP_000893481.1.77960 WP_000893481.1.77983 WP_000893481.1.78 WP_000893481.1.7802 WP_000893481.1.78051 WP_000893481.1.78096 WP_000893481.1.78110 WP_000893481.1.78168 WP_000893481.1.78201 WP_000893481.1.78301 WP_000893481.1.78339 WP_000893481.1.78366 WP_000893481.1.78372 WP_000893481.1.78383 WP_000893481.1.78443 WP_000893481.1.78496 WP_000893481.1.78501 WP_000893481.1.78568 WP_000893481.1.78602 WP_000893481.1.78603 WP_000893481.1.7861 WP_000893481.1.78618 WP_000893481.1.78632 WP_000893481.1.78658 WP_000893481.1.78673 WP_000893481.1.78697 WP_000893481.1.78734 WP_000893481.1.78735 WP_000893481.1.78738 WP_000893481.1.7877 WP_000893481.1.78789 WP_000893481.1.78815 WP_000893481.1.78830 WP_000893481.1.78838 WP_000893481.1.78871 WP_000893481.1.78874 WP_000893481.1.78877 WP_000893481.1.78881 WP_000893481.1.78896 WP_000893481.1.78913 WP_000893481.1.78918 WP_000893481.1.78930 WP_000893481.1.79011 WP_000893481.1.79032 WP_000893481.1.79099 WP_000893481.1.79167 WP_000893481.1.79189 WP_000893481.1.79203 WP_000893481.1.79289 WP_000893481.1.79300 WP_000893481.1.79302 WP_000893481.1.79335 WP_000893481.1.794 WP_000893481.1.79462 WP_000893481.1.79466 WP_000893481.1.79468 WP_000893481.1.79472 WP_000893481.1.79490 WP_000893481.1.79495 WP_000893481.1.7956 WP_000893481.1.79580 WP_000893481.1.79586 WP_000893481.1.79645 WP_000893481.1.79659 WP_000893481.1.79668 WP_000893481.1.79708 WP_000893481.1.79734 WP_000893481.1.79757 WP_000893481.1.79778 WP_000893481.1.7979 WP_000893481.1.7982 WP_000893481.1.79842 WP_000893481.1.79845 WP_000893481.1.79892 WP_000893481.1.7991 WP_000893481.1.79910 WP_000893481.1.79914 WP_000893481.1.79929 WP_000893481.1.7994 WP_000893481.1.79942 WP_000893481.1.79966 WP_000893481.1.79974 WP_000893481.1.79996 WP_000893481.1.80137 WP_000893481.1.80182 WP_000893481.1.8024 WP_000893481.1.80249 WP_000893481.1.80250 WP_000893481.1.80254 WP_000893481.1.80293 WP_000893481.1.80296 WP_000893481.1.80333 WP_000893481.1.80366 WP_000893481.1.80380 WP_000893481.1.80441 WP_000893481.1.80443 WP_000893481.1.80473 WP_000893481.1.80480 WP_000893481.1.80496 WP_000893481.1.80529 WP_000893481.1.80542 WP_000893481.1.80586 WP_000893481.1.80638 WP_000893481.1.80667 WP_000893481.1.80674 WP_000893481.1.80705 WP_000893481.1.80723 WP_000893481.1.80725 WP_000893481.1.80741 WP_000893481.1.80750 WP_000893481.1.80757 WP_000893481.1.80760 WP_000893481.1.80780 WP_000893481.1.80803 WP_000893481.1.80850 WP_000893481.1.80868 WP_000893481.1.80874 WP_000893481.1.80876 WP_000893481.1.80881 WP_000893481.1.80913 WP_000893481.1.80939 WP_000893481.1.80941 WP_000893481.1.80959 WP_000893481.1.8096 WP_000893481.1.80973 WP_000893481.1.81041 WP_000893481.1.81109 WP_000893481.1.81110 WP_000893481.1.81175 WP_000893481.1.81197 WP_000893481.1.81225 WP_000893481.1.81231 WP_000893481.1.81275 WP_000893481.1.81321 WP_000893481.1.8134 WP_000893481.1.81354 WP_000893481.1.81388 WP_000893481.1.81404 WP_000893481.1.81410 WP_000893481.1.81455 WP_000893481.1.81528 WP_000893481.1.81612 WP_000893481.1.81668 WP_000893481.1.8168 WP_000893481.1.81727 WP_000893481.1.81735 WP_000893481.1.81743 WP_000893481.1.81746 WP_000893481.1.81750 WP_000893481.1.81785 WP_000893481.1.8196 WP_000893481.1.81974 WP_000893481.1.81977 WP_000893481.1.82037 WP_000893481.1.82141 WP_000893481.1.82144 WP_000893481.1.82192 WP_000893481.1.82258 WP_000893481.1.82269 WP_000893481.1.82337 WP_000893481.1.82347 WP_000893481.1.82352 WP_000893481.1.8236 WP_000893481.1.82369 WP_000893481.1.82434 WP_000893481.1.82464 WP_000893481.1.8247 WP_000893481.1.82474 WP_000893481.1.82515 WP_000893481.1.82530 WP_000893481.1.82569 WP_000893481.1.82570 WP_000893481.1.82584 WP_000893481.1.82637 WP_000893481.1.82648 WP_000893481.1.82761 WP_000893481.1.8282 WP_000893481.1.82843 WP_000893481.1.82899 WP_000893481.1.82944 WP_000893481.1.83005 WP_000893481.1.83119 WP_000893481.1.83139 WP_000893481.1.83163 WP_000893481.1.83221 WP_000893481.1.83247 WP_000893481.1.83252 WP_000893481.1.83258 WP_000893481.1.83280 WP_000893481.1.83301 WP_000893481.1.83305 WP_000893481.1.83331 WP_000893481.1.83354 WP_000893481.1.83356 WP_000893481.1.83360 WP_000893481.1.83378 WP_000893481.1.83382 WP_000893481.1.83388 WP_000893481.1.83413 WP_000893481.1.83510 WP_000893481.1.83523 WP_000893481.1.83558 WP_000893481.1.83598 WP_000893481.1.83632 WP_000893481.1.83650 WP_000893481.1.83838 WP_000893481.1.83854 WP_000893481.1.83897 WP_000893481.1.83960 WP_000893481.1.8399 WP_000893481.1.83995 WP_000893481.1.84000 WP_000893481.1.84001 WP_000893481.1.84011 WP_000893481.1.84075 WP_000893481.1.84077 WP_000893481.1.84100 WP_000893481.1.84106 WP_000893481.1.84179 WP_000893481.1.84198 WP_000893481.1.84205 WP_000893481.1.84209 WP_000893481.1.8425 WP_000893481.1.84291 WP_000893481.1.84300 WP_000893481.1.84325 WP_000893481.1.84355 WP_000893481.1.84359 WP_000893481.1.84392 WP_000893481.1.84397 WP_000893481.1.84403 WP_000893481.1.84459 WP_000893481.1.84497 WP_000893481.1.84515 WP_000893481.1.84523 WP_000893481.1.84532 WP_000893481.1.84551 WP_000893481.1.84572 WP_000893481.1.84598 WP_000893481.1.84644 WP_000893481.1.84683 WP_000893481.1.84693 WP_000893481.1.84721 WP_000893481.1.84814 WP_000893481.1.84860 WP_000893481.1.84899 WP_000893481.1.84983 WP_000893481.1.85031 WP_000893481.1.85040 WP_000893481.1.85079 WP_000893481.1.85147 WP_000893481.1.85178 WP_000893481.1.85180 WP_000893481.1.85192 WP_000893481.1.8526 WP_000893481.1.85271 WP_000893481.1.85301 WP_000893481.1.8537 WP_000893481.1.85408 WP_000893481.1.8545 WP_000893481.1.85456 WP_000893481.1.85469 WP_000893481.1.85481 WP_000893481.1.85483 WP_000893481.1.85541 WP_000893481.1.8556 WP_000893481.1.85568 WP_000893481.1.85617 WP_000893481.1.85654 WP_000893481.1.85672 WP_000893481.1.85675 WP_000893481.1.85759 WP_000893481.1.85777 WP_000893481.1.85784 WP_000893481.1.85854 WP_000893481.1.85855 WP_000893481.1.85864 WP_000893481.1.8591 WP_000893481.1.85943 WP_000893481.1.85976 WP_000893481.1.85982 WP_000893481.1.86007 WP_000893481.1.86010 WP_000893481.1.86017 WP_000893481.1.86043 WP_000893481.1.86120 WP_000893481.1.86126 WP_000893481.1.86138 WP_000893481.1.86157 WP_000893481.1.86159 WP_000893481.1.8616 WP_000893481.1.86206 WP_000893481.1.86224 WP_000893481.1.86259 WP_000893481.1.86284 WP_000893481.1.86316 WP_000893481.1.86347 WP_000893481.1.86380 WP_000893481.1.86450 WP_000893481.1.86469 WP_000893481.1.8647 WP_000893481.1.86514 WP_000893481.1.86580 WP_000893481.1.86588 WP_000893481.1.86593 WP_000893481.1.86601 WP_000893481.1.86610 WP_000893481.1.86656 WP_000893481.1.86676 WP_000893481.1.86699 WP_000893481.1.86735 WP_000893481.1.86744 WP_000893481.1.86769 WP_000893481.1.86807 WP_000893481.1.86810 WP_000893481.1.86859 WP_000893481.1.86895 WP_000893481.1.86915 WP_000893481.1.86921 WP_000893481.1.86982 WP_000893481.1.87038 WP_000893481.1.87095 WP_000893481.1.87143 WP_000893481.1.87148 WP_000893481.1.87187 WP_000893481.1.87219 WP_000893481.1.8722 WP_000893481.1.87265 WP_000893481.1.87282 WP_000893481.1.87283 WP_000893481.1.87346 WP_000893481.1.8736 WP_000893481.1.87365 WP_000893481.1.87370 WP_000893481.1.87460 WP_000893481.1.87484 WP_000893481.1.87500 WP_000893481.1.87552 WP_000893481.1.87583 WP_000893481.1.87584 WP_000893481.1.87618 WP_000893481.1.87651 WP_000893481.1.8767 WP_000893481.1.87695 WP_000893481.1.87712 WP_000893481.1.87760 WP_000893481.1.87813 WP_000893481.1.87899 WP_000893481.1.87905 WP_000893481.1.8792 WP_000893481.1.87936 WP_000893481.1.87999 WP_000893481.1.88014 WP_000893481.1.88019 WP_000893481.1.88052 WP_000893481.1.88092 WP_000893481.1.88136 WP_000893481.1.88165 WP_000893481.1.88185 WP_000893481.1.88214 WP_000893481.1.88264 WP_000893481.1.88275 WP_000893481.1.88291 WP_000893481.1.88293 WP_000893481.1.88356 WP_000893481.1.88393 WP_000893481.1.88423 WP_000893481.1.8849 WP_000893481.1.88508 WP_000893481.1.88609 WP_000893481.1.88675 WP_000893481.1.88703 WP_000893481.1.88731 WP_000893481.1.88762 WP_000893481.1.88845 WP_000893481.1.88854 WP_000893481.1.88942 WP_000893481.1.88957 WP_000893481.1.88966 WP_000893481.1.88967 WP_000893481.1.88968 WP_000893481.1.88970 WP_000893481.1.88981 WP_000893481.1.88995 WP_000893481.1.88998 WP_000893481.1.89008 WP_000893481.1.89054 WP_000893481.1.89116 WP_000893481.1.89119 WP_000893481.1.89120 WP_000893481.1.89174 WP_000893481.1.89177 WP_000893481.1.89188 WP_000893481.1.89215 WP_000893481.1.89221 WP_000893481.1.89291 WP_000893481.1.89311 WP_000893481.1.89354 WP_000893481.1.89355 WP_000893481.1.89408 WP_000893481.1.89425 WP_000893481.1.89452 WP_000893481.1.89527 WP_000893481.1.89570 WP_000893481.1.8958 WP_000893481.1.89606 WP_000893481.1.8961 WP_000893481.1.89622 WP_000893481.1.89634 WP_000893481.1.89647 WP_000893481.1.89657 WP_000893481.1.89659 WP_000893481.1.89680 WP_000893481.1.89777 WP_000893481.1.89832 WP_000893481.1.89914 WP_000893481.1.89940 WP_000893481.1.8996 WP_000893481.1.89975 WP_000893481.1.9002 WP_000893481.1.9003 WP_000893481.1.90084 WP_000893481.1.90097 WP_000893481.1.90108 WP_000893481.1.90193 WP_000893481.1.90211 WP_000893481.1.90252 WP_000893481.1.90302 WP_000893481.1.90311 WP_000893481.1.90363 WP_000893481.1.90409 WP_000893481.1.90417 WP_000893481.1.90421 WP_000893481.1.90440 WP_000893481.1.90453 WP_000893481.1.90458 WP_000893481.1.90522 WP_000893481.1.90540 WP_000893481.1.90563 WP_000893481.1.90585 WP_000893481.1.90620 WP_000893481.1.90625 WP_000893481.1.90641 WP_000893481.1.90734 WP_000893481.1.90748 WP_000893481.1.90752 WP_000893481.1.90759 WP_000893481.1.90792 WP_000893481.1.90814 WP_000893481.1.90859 WP_000893481.1.90876 WP_000893481.1.9093 WP_000893481.1.90959 WP_000893481.1.90973 WP_000893481.1.90983 WP_000893481.1.90984 WP_000893481.1.91023 WP_000893481.1.91042 WP_000893481.1.91049 WP_000893481.1.91056 WP_000893481.1.91069 WP_000893481.1.91107 WP_000893481.1.91179 WP_000893481.1.91215 WP_000893481.1.91312 WP_000893481.1.91334 WP_000893481.1.9137 WP_000893481.1.91372 WP_000893481.1.91381 WP_000893481.1.91424 WP_000893481.1.91453 WP_000893481.1.91473 WP_000893481.1.91474 WP_000893481.1.91505 WP_000893481.1.91524 WP_000893481.1.91528 WP_000893481.1.91536 WP_000893481.1.91579 WP_000893481.1.91625 WP_000893481.1.91628 WP_000893481.1.91702 WP_000893481.1.91724 WP_000893481.1.91732 WP_000893481.1.91772 WP_000893481.1.91795 WP_000893481.1.91806 WP_000893481.1.91898 WP_000893481.1.91904 WP_000893481.1.91974 WP_000893481.1.92013 WP_000893481.1.92044 WP_000893481.1.92047 WP_000893481.1.92060 WP_000893481.1.92067 WP_000893481.1.92068 WP_000893481.1.92082 WP_000893481.1.92093 WP_000893481.1.92099 WP_000893481.1.92108 WP_000893481.1.92122 WP_000893481.1.92129 WP_000893481.1.92165 WP_000893481.1.92171 WP_000893481.1.9222 WP_000893481.1.92399 WP_000893481.1.92408 WP_000893481.1.92411 WP_000893481.1.92439 WP_000893481.1.92443 WP_000893481.1.92452 WP_000893481.1.92482 WP_000893481.1.92529 WP_000893481.1.92531 WP_000893481.1.92557 WP_000893481.1.92669 WP_000893481.1.92671 WP_000893481.1.9276 WP_000893481.1.92806 WP_000893481.1.92827 WP_000893481.1.92836 WP_000893481.1.92842 WP_000893481.1.92875 WP_000893481.1.92883 WP_000893481.1.92890 WP_000893481.1.92893 WP_000893481.1.92926 WP_000893481.1.92929 WP_000893481.1.92975 WP_000893481.1.93059 WP_000893481.1.93061 WP_000893481.1.93076 WP_000893481.1.93101 WP_000893481.1.93136 WP_000893481.1.93155 WP_000893481.1.93215 WP_000893481.1.93275 WP_000893481.1.93322 WP_000893481.1.93339 WP_000893481.1.93524 WP_000893481.1.93543 WP_000893481.1.93577 WP_000893481.1.93596 WP_000893481.1.93648 WP_000893481.1.93656 WP_000893481.1.93662 WP_000893481.1.93705 WP_000893481.1.93761 WP_000893481.1.9380 WP_000893481.1.93804 WP_000893481.1.93809 WP_000893481.1.93937 WP_000893481.1.93956 WP_000893481.1.93986 WP_000893481.1.94056 WP_000893481.1.94072 WP_000893481.1.94168 WP_000893481.1.94352 WP_000893481.1.94379 WP_000893481.1.94383 WP_000893481.1.9440 WP_000893481.1.94458 WP_000893481.1.94557 WP_000893481.1.94562 WP_000893481.1.94584 WP_000893481.1.94598 WP_000893481.1.94622 WP_000893481.1.94670 WP_000893481.1.94722 WP_000893481.1.94785 WP_000893481.1.94796 WP_000893481.1.94798 WP_000893481.1.9481 WP_000893481.1.94817 WP_000893481.1.94835 WP_000893481.1.94849 WP_000893481.1.94921 WP_000893481.1.94947 WP_000893481.1.94959 WP_000893481.1.94971 WP_000893481.1.94986 WP_000893481.1.9503 WP_000893481.1.95051 WP_000893481.1.95085 WP_000893481.1.95094 WP_000893481.1.95121 WP_000893481.1.95136 WP_000893481.1.95152 WP_000893481.1.95171 WP_000893481.1.95235 WP_000893481.1.95248 WP_000893481.1.95249 WP_000893481.1.9527 WP_000893481.1.95277 WP_000893481.1.95282 WP_000893481.1.95298 WP_000893481.1.95388 WP_000893481.1.95404 WP_000893481.1.95447 WP_000893481.1.95456 WP_000893481.1.95546 WP_000893481.1.95579 WP_000893481.1.95607 WP_000893481.1.95641 WP_000893481.1.95656 WP_000893481.1.95691 WP_000893481.1.95729 WP_000893481.1.9574 WP_000893481.1.95757 WP_000893481.1.95803 WP_000893481.1.95826 WP_000893481.1.9586 WP_000893481.1.95866 WP_000893481.1.95939 WP_000893481.1.95963 WP_000893481.1.96004 WP_000893481.1.96045 WP_000893481.1.9609 WP_000893481.1.96107 WP_000893481.1.96139 WP_000893481.1.96162 WP_000893481.1.96172 WP_000893481.1.96190 WP_000893481.1.96203 WP_000893481.1.96206 WP_000893481.1.9624 WP_000893481.1.96260 WP_000893481.1.9627 WP_000893481.1.96340 WP_000893481.1.96348 WP_000893481.1.96349 WP_000893481.1.9644 WP_000893481.1.96469 WP_000893481.1.96521 WP_000893481.1.96533 WP_000893481.1.96537 WP_000893481.1.96555 WP_000893481.1.96563 WP_000893481.1.96584 WP_000893481.1.96588 WP_000893481.1.96640 WP_000893481.1.96642 WP_000893481.1.96662 WP_000893481.1.96721 WP_000893481.1.96732 WP_000893481.1.96735 WP_000893481.1.96758 WP_000893481.1.96761 WP_000893481.1.96810 WP_000893481.1.96876 WP_000893481.1.96902 WP_000893481.1.96917 WP_000893481.1.96993 WP_000893481.1.97005 WP_000893481.1.97015 WP_000893481.1.97043 WP_000893481.1.97109 WP_000893481.1.97145 WP_000893481.1.97190 WP_000893481.1.97260 WP_000893481.1.97297 WP_000893481.1.97318 WP_000893481.1.97322 WP_000893481.1.97328 WP_000893481.1.97369 WP_000893481.1.97477 WP_000893481.1.97480 WP_000893481.1.97487 WP_000893481.1.97534 WP_000893481.1.97547 WP_000893481.1.97594 WP_000893481.1.97597 WP_000893481.1.97604 WP_000893481.1.97626 WP_000893481.1.97628 WP_000893481.1.97640 WP_000893481.1.97656 WP_000893481.1.97704 WP_000893481.1.97725 WP_000893481.1.97726 WP_000893481.1.97727 WP_000893481.1.97732 WP_000893481.1.9774 WP_000893481.1.97846 WP_000893481.1.97873 WP_000893481.1.9793 WP_000893481.1.97981 WP_000893481.1.97983 WP_000893481.1.9799 WP_000893481.1.97991 WP_000893481.1.98006 WP_000893481.1.98022 WP_000893481.1.9805 WP_000893481.1.98107 WP_000893481.1.9811 WP_000893481.1.98110 WP_000893481.1.98119 WP_000893481.1.98124 WP_000893481.1.98146 WP_000893481.1.98170 WP_000893481.1.98250 WP_000893481.1.98338 WP_000893481.1.98392 WP_000893481.1.98402 WP_000893481.1.98438 WP_000893481.1.98472 WP_000893481.1.98483 WP_000893481.1.98495 WP_000893481.1.98513 WP_000893481.1.98551 WP_000893481.1.98608 WP_000893481.1.9863 WP_000893481.1.98634 WP_000893481.1.98676 WP_000893481.1.98677 WP_000893481.1.98726 WP_000893481.1.98751 WP_000893481.1.98843 WP_000893481.1.98899 WP_000893481.1.98931 WP_000893481.1.98947 WP_000893481.1.9898 WP_000893481.1.9899 WP_000893481.1.99040 WP_000893481.1.99072 WP_000893481.1.99073 WP_000893481.1.99097 WP_000893481.1.99164 WP_000893481.1.99184 WP_000893481.1.9919 WP_000893481.1.99198 WP_000893481.1.99215 WP_000893481.1.99219 WP_000893481.1.99267 WP_000893481.1.99276 WP_000893481.1.99278 WP_000893481.1.99327 WP_000893481.1.99469 WP_000893481.1.99490 WP_000893481.1.99493 WP_000893481.1.99577 WP_000893481.1.99613 WP_000893481.1.99626 WP_000893481.1.99630 WP_000893481.1.99637 WP_000893481.1.99646 WP_000893481.1.99657 WP_000893481.1.99712 WP_000893481.1.99747 WP_000893481.1.99783 WP_000893481.1.99824 WP_000893481.1.99858 WP_000893481.1.99889 WP_000893481.1.99924 WP_000893481.1.99958 gi|549480636|ref|YP_008614914.1| APC23981 IDP00075 gi|378956880|ref|YP_005214367.1| gi|378985863|ref|YP_005249019.1| gi|207858516|ref|YP_002245167.1| gi|563654620|ref|YP_008862706.1| gi|194737613|ref|YP_002116218.1| gi|529221059|ref|YP_008382505.1| gi|482905834|ref|YP_007904394.1| gi|378452083|ref|YP_005239443.1| gi|198242351|ref|YP_002217240.1| gi|409246981|ref|YP_006887683.1| gi|525836894|ref|YP_008253552.1| gi|161616272|ref|YP_001590237.1| ABAK02000001|CDS_2754135-2754725 ABAM02000001|CDS_3809093-3809683 ABAN01000014|CDS_57715-57125 ABAO01000002|CDS_31407-30817 ABEH02000003|CDS_455817-456407 ABEI01000008|CDS_157038-157628 ABEJ01000014|CDS_56511-57101 ABEL01000006|CDS_157069-157659 ABEW01000002|CDS_129609-129019 ABFF01000005|CDS_74125-73535 ABFG01000007|CDS_134888-134298 ABFH02000001|CDS_1731823-1731233 AE006468|CDS_3435744-3436334 AE017220|CDS_3391771-3392361 AM933172|CDS_3317778-3318368 AM933173|CDS_3295047-3295637 CP000857|CDS_3370094-3370684 CP000886|CDS_3395988-3396578 CP001113|CDS_3419160-3419750 CP001120|CDS_3452414-3453004 CP001127|CDS_3337586-3338176 CP001138|CDS_3352955-3353545 CP001144|CDS_3476871-3477461 CP001363|CDS_3448928-3449518 FN424405|CDS_3458168-3458758 NZ_ACBF01000001|CDS_589516-590106 gi|378446653|ref|YP_005234285.1| gi|526229299|ref|YP_008323942.1| gi|383497921|ref|YP_005398610.1| gi|378701168|ref|YP_005183125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]